Align Succinylornithine transaminase (EC 2.6.1.81) (characterized)
to candidate WP_004298659.1 C665_RS01920 aspartate aminotransferase family protein
Query= reanno::Koxy:BWI76_RS11670 (406 letters) >NCBI__GCF_000310185.1:WP_004298659.1 Length = 391 Score = 261 bits (667), Expect = 3e-74 Identities = 160/393 (40%), Positives = 217/393 (55%), Gaps = 11/393 (2%) Query: 14 MMPVYA--PAAFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPRLVKALTEQAGKF 71 +M YA P AF GEG L+D+ GK Y+D GIAVN LG+ HPRLVKA+ +QA + Sbjct: 4 VMNTYARLPVAF--THGEGVWLYDETGKRYLDALSGIAVNTLGYKHPRLVKAIADQAERV 61 Query: 72 WHTGNGYTNEPVLRLAKQLIDATFADRVFFCNSGAEANEAALKLARKYAHDRFGSEKSGI 131 HT N Y +L+ ++ +A D VFFCNSG EANEAA+KLAR Y H++ G E I Sbjct: 62 LHTSNLYRIPLQEQLSDRIAEAAGMDEVFFCNSGCEANEAAIKLARMYGHNK-GIELPHI 120 Query: 132 VAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPQIQHAIYNDLDSAKALIDDN--TCAVIV 189 + +NAFHGRT+ T+SA G F PL Y D+++ + + + N AV++ Sbjct: 121 IVMENAFHGRTMATLSATGNRKAQAGFEPLVQGFIRVPYKDIEAIRKIAEHNHTVVAVML 180 Query: 190 EPMQGEGGVVPADADFLRGLRELCDAHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLS 249 E +QGEGGV AD F R LR LCD L+I DEVQ G+GRTG+ + + H G PD+++ Sbjct: 181 EMIQGEGGVNVADEAFQRDLRALCDDRGWLMICDEVQCGMGRTGKWFGWQHAGTRPDVMT 240 Query: 250 TAKALGGGFPIGALLASERCASVMTVGTHGTTYGGNPLACAVAGEVFATINTREVLNGVK 309 AK L G PIGA + S + G HG+T+GGNPLACA F I E+++ Sbjct: 241 LAKGLASGVPIGACVTSGLAKGLFGPGNHGSTFGGNPLACAAGLATFDAIVEDELMDNAV 300 Query: 310 QRHQWFCERLNAINARYGLFKEIRGLGLLIGCVLKDEYAGKAKAISNQAAEEGLMILIAG 369 + + A +IRG GL+IG L D G A +AAE GL++ + Sbjct: 301 AVGAAIRKGMAEALAGEAGVVDIRGRGLMIGIEL-DRPCGVLMA---RAAENGLLLSVTS 356 Query: 370 ANVVRFAPALIISEDEVNSGLDRFELACKRFLA 402 VVR PAL + + + + + FLA Sbjct: 357 ERVVRLLPALTFTTADAQTLVSMLAPMIRDFLA 389 Lambda K H 0.321 0.137 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 437 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 391 Length adjustment: 31 Effective length of query: 375 Effective length of database: 360 Effective search space: 135000 Effective search space used: 135000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory