Align Ornithine aminotransferase; OAT; EC 2.6.1.13; Ornithine--oxo-acid aminotransferase (uncharacterized)
to candidate WP_004298659.1 C665_RS01920 aspartate aminotransferase family protein
Query= curated2:C3P3K3 (396 letters) >NCBI__GCF_000310185.1:WP_004298659.1 Length = 391 Score = 247 bits (631), Expect = 4e-70 Identities = 136/373 (36%), Positives = 203/373 (54%), Gaps = 8/373 (2%) Query: 17 NNYHPLPIVISKAEGVWVEDPEGNRYMDLLSAYSAVNQGHRHPKIINALIDQANRVTLTS 76 N Y LP+ + EGVW+ D G RY+D LS + G++HP+++ A+ DQA RV TS Sbjct: 6 NTYARLPVAFTHGEGVWLYDETGKRYLDALSGIAVNTLGYKHPRLVKAIADQAERVLHTS 65 Query: 77 RAFHSDQLGPWYEKVAKLTNKEMVLPMNTGAEAVETAIKTARRWAYDVKKVEANRAEIIV 136 + +++A+ + V N+G EA E AIK AR + ++ K +E IIV Sbjct: 66 NLYRIPLQEQLSDRIAEAAGMDEVFFCNSGCEANEAAIKLARMYGHN-KGIEL--PHIIV 122 Query: 137 CEDNFHGRTMGAVSMSSNEEYKRGFGPMLPGIIVIPYGDLEALKAAITPN--TAAFILEP 194 E+ FHGRTM +S + N + + GF P++ G I +PY D+EA++ N A +LE Sbjct: 123 MENAFHGRTMATLSATGNRKAQAGFEPLVQGFIRVPYKDIEAIRKIAEHNHTVVAVMLEM 182 Query: 195 IQGEAGINIPPAGFLKEALEVCKKENVLFVADEIQTGLGRTGKVFACDWDNVTPDMYILG 254 IQGE G+N+ F ++ +C L + DE+Q G+GRTGK F PD+ L Sbjct: 183 IQGEGGVNVADEAFQRDLRALCDDRGWLMICDEVQCGMGRTGKWFGWQHAGTRPDVMTLA 242 Query: 255 KALGGGVFPISCAAANRDILGVFEPGSHGSTFGGNPLACAVSIAALEVLEEEKLTERSLQ 314 K L GV PI + G+F PG+HGSTFGGNPLACA +A + + E++L + ++ Sbjct: 243 KGLASGV-PIGACVTSGLAKGLFGPGNHGSTFGGNPLACAAGLATFDAIVEDELMDNAVA 301 Query: 315 LGEKLVGQLKE--IDNPMITEVRGKGLFIGIELNEPARPYCEQLKAAGLLCKETHENVIR 372 +G + + E + ++RG+GL IGIEL+ P + GLL T E V+R Sbjct: 302 VGAAIRKGMAEALAGEAGVVDIRGRGLMIGIELDRPCGVLMARAAENGLLLSVTSERVVR 361 Query: 373 IAPPLVISEEDLE 385 + P L + D + Sbjct: 362 LLPALTFTTADAQ 374 Lambda K H 0.317 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 375 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 396 Length of database: 391 Length adjustment: 31 Effective length of query: 365 Effective length of database: 360 Effective search space: 131400 Effective search space used: 131400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory