Align Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 (uncharacterized)
to candidate WP_007694040.1 C447_RS11500 diaminobutyrate--2-oxoglutarate transaminase
Query= curated2:Q8TUZ5 (389 letters) >NCBI__GCF_000336675.1:WP_007694040.1 Length = 454 Score = 213 bits (543), Expect = 7e-60 Identities = 143/422 (33%), Positives = 216/422 (51%), Gaps = 49/422 (11%) Query: 14 TYSR-FPVTLVPGEGARVWDDEGNEYIDLVAGIAVNVLGHCHPAVVEAVKEQVERLIHCS 72 TY R P + G V D +GNEY D +AG LGH HP VVEA++ ++ Sbjct: 24 TYPRHLPFAIREATGVTVTDMDGNEYYDCLAGAGTLALGHNHPRVVEAMERVIDEDRPIH 83 Query: 73 NLYYNEPQAEA-ARLLAEAAPKDLN---KVFFCN-SGTESVECAIKLARKFTGCTKFIAF 127 L + P E L E+ P + K+ FC+ +GT++VE A+KL + TG + F Sbjct: 84 TLDISTPTKERFVDSLFESLPDEFTDRAKIQFCSPAGTDAVEAALKLVKTATGNRSVLGF 143 Query: 128 EGGFHGRTMGALSATWKPEFREPFEPLVPEFEHVPYG----------------------- 164 +G +HG T GAL + + E H+PY Sbjct: 144 QGAYHGMTSGALGLMGDVDVKGTLPASTGEVHHLPYPSNYRPPFGVGGEEGHRIASRYVR 203 Query: 165 DVNAVEKAIDDDTAAVIVEPVQGEAGVRIPPEGFLRELRELCDEHGLLLIVDEVQSGMGR 224 ++ A K+ D A +I+EP+QGE G P+ +LRE+R + EH + LI+DE+Q+G+GR Sbjct: 204 NLLADSKSGITDPAGMILEPIQGEGGSVPAPDEWLREMRRITREHDIPLILDEIQTGLGR 263 Query: 225 TGQFFAFEHEDVLPDIVCLAKGLGGGVPVGATIAREEVAEAFEPGDHGSTFGGNPLACAA 284 TG+ +AFEH D++PD+V L+K +GGG+P+ A + +E + +EPG H TF GN LA AA Sbjct: 264 TGETYAFEHADIVPDVVTLSKAIGGGLPL-AVVVYDESLDVWEPGAHAGTFRGNQLAMAA 322 Query: 285 VCAAVSTVLEENLPEAAE---RKGKLAMRILSEAEDVVEEVRGRGLMMGVE--------- 332 A + V+E +L E A R+ + A +E + V +VRGRGLM+GVE Sbjct: 323 GEATIDHVVENDLAEHAADVGRRLREAFEATAERFEAVGDVRGRGLMLGVEFVDHGAEWQ 382 Query: 333 -----VGDDERAKDVAREMLDRGALVNVTS-GD-VIRLVPPLVIGEDELEKALAELADAL 385 D + A+ V +RG +V GD R +PPL++ ++++ +A+ Sbjct: 383 GPGPHAPDGDFAEAVQAACFERGLVVERGGRGDATARFLPPLIVTRAQVDEIATIFEEAV 442 Query: 386 RA 387 A Sbjct: 443 AA 444 Lambda K H 0.318 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 450 Number of extensions: 29 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 389 Length of database: 454 Length adjustment: 32 Effective length of query: 357 Effective length of database: 422 Effective search space: 150654 Effective search space used: 150654 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory