Align Glutamyl-tRNA(Gln) amidotransferase subunit D; Glu-ADT subunit D; EC 6.3.5.- (uncharacterized)
to candidate WP_004043218.1 C498_RS09825 asparaginase
Query= curated2:O26802 (435 letters) >NCBI__GCF_000337315.1:WP_004043218.1 Length = 324 Score = 151 bits (382), Expect = 2e-41 Identities = 118/323 (36%), Positives = 163/323 (50%), Gaps = 16/323 (4%) Query: 91 PDVSIISTGGTVASIIDYRTGAVHPAFTADDLLRANPELLDIANIRGRAVFNILSENMKP 150 P V+++STGGT+AS D GA P+ L+ A PEL + A + R V S +M Sbjct: 3 PQVTVLSTGGTIAST-DGEGGAT-PSKRGAALVDAVPELGEYAEVEVRDVALRPSFDMDF 60 Query: 151 EYWVETARAVYGEIKDGADGVVVAHGTDTMHYTSAALSFMLRTPVPVVFTGAQRSSDRPS 210 E TA A DGADGVVV HGTDTM ++ L L VPVVFTGAQR + S Sbjct: 61 ETVAATAHAARDAAVDGADGVVVTHGTDTMEESAYYLDLALDLDVPVVFTGAQRRPNEVS 120 Query: 211 SDASLNIQCSVRAATSEIAEVTVCMHATMDDLSCHLHRGVKVRKMHTSRRDTFRSMNALP 270 +D N+ +VRAA E ++ D+ LH K+HTS D F S +A P Sbjct: 121 ADGPSNLLTAVRAAVDESFTGRGGVYVAFDE---QLHAARDATKIHTSDLDAFASPDASP 177 Query: 271 LAEVTPDGIKILEENYRKRGSDELELSDRVE--ERVAFIKSYPGISPDIIKWHLDEGYRG 328 +A T +G ++L RK GS + D +E + VA ++SY G ++ ++ G G Sbjct: 178 VARFTREGTRLL----RKPGSRSASV-DAIESSKDVAVVQSYIGADDRQLRSVVEAGADG 232 Query: 329 IVIEGTGLGHCPDTLIPVIGEAHDMGVPVAMTSQCLNGRVNMNVYST---GRRLLQAGVI 385 +V+EGTGLG+ + L G + G PV +T++C G V VY + G L VI Sbjct: 233 VVLEGTGLGNATNALGEAAGSLAEDGYPVVVTTRCQGGAV-APVYGSPGGGETLRDRRVI 291 Query: 386 PCDDMLPEVAYVKMCWVLGQTDD 408 D+ A +K+ VL D Sbjct: 292 DGSDLPAHKARIKLMLVLESVGD 314 Lambda K H 0.318 0.135 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 387 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 435 Length of database: 324 Length adjustment: 30 Effective length of query: 405 Effective length of database: 294 Effective search space: 119070 Effective search space used: 119070 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory