Align O-succinylhomoserine sulfhydrylase; OSH sulfhydrylase; OSHS sulfhydrylase; EC 2.5.1.- (characterized)
to candidate WP_004044791.1 C498_RS17335 PLP-dependent aspartate aminotransferase family protein
Query= SwissProt::P55218 (403 letters) >NCBI__GCF_000337315.1:WP_004044791.1 Length = 401 Score = 275 bits (703), Expect = 2e-78 Identities = 144/341 (42%), Positives = 212/341 (62%), Gaps = 3/341 (0%) Query: 66 VYSRYTNPTVRTFEERIAALEGAEQAVATASGMSAILALVMSLCSSGDHVLVSRSVFGST 125 +YSR +NPT E R+AALEGA+ A+A SG +AI A + ++ GDH++ ++G T Sbjct: 61 LYSRLSNPTRNALEHRLAALEGADHALAFVSGTAAIAATMTAVVRPGDHIVAFEDLYGGT 120 Query: 126 ISLFDKYFK-RFGIQVDYPPLSDLAAWEAACKPNTKLFFVESPSNPLAELVDIAALAEIA 184 ++ + F R + V + +D AA + T L ++E+P+NPL L DI A+A IA Sbjct: 121 KTMLTRLFADRLNVDVSFVDATDPENVAAAMREETALVWMETPTNPLMHLCDIEAIAAIA 180 Query: 185 HAKGALLAVDNCFCTPALQQPLKLGADVVIHSATKYIDGQGRGMGGVVAGRGEQMKEVVG 244 A+ VDN F +P Q PL LGADVV+HS TKY++G +GG V E + E + Sbjct: 181 DEGDAVFGVDNTFLSPQFQTPLSLGADVVVHSTTKYLNGHSDSIGGAVVTDREDVLEELT 240 Query: 245 FLRTAG--PTLSPFNAWLFLKGLETLRIRMQAHSASALALAEWLERQPGIERVYYAGLPS 302 FL+ G LSPF+++L L+G++TL +RM+ H +A+ +AE+L+ + RV Y GL S Sbjct: 241 FLQRVGMGSMLSPFDSYLTLRGIKTLPLRMRQHETNAMEIAEFLDSHEAVTRVLYPGLES 300 Query: 303 HPQHELARRQQSGFGAVVSFDVKGGRDAAWRFIDATRMVSITTNLGDTKTTIAHPATTSH 362 HPQH+LA RQQSGFG V+SF++ D F+ A R + +LG ++ I HPAT +H Sbjct: 301 HPQHDLAARQQSGFGGVLSFELDTDLDGTAEFLGALREFPLAVSLGGVESLIEHPATMTH 360 Query: 363 GRLSPEDRARAGIGDSLIRVAVGLEDLDDLKADMARGLAAL 403 LS +R GI DSL+R++VG+E +DDL++D+A L+ L Sbjct: 361 SPLSQTERDALGISDSLLRLSVGVEHVDDLRSDLASALSVL 401 Lambda K H 0.319 0.133 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 401 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 403 Length of database: 401 Length adjustment: 31 Effective length of query: 372 Effective length of database: 370 Effective search space: 137640 Effective search space used: 137640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory