Align Probable cystathionine beta-synthase Rv1077; Beta-thionase; Serine sulfhydrase; EC 4.2.1.22 (characterized)
to candidate WP_017598874.1 D471_RS0112200 pyridoxal-phosphate dependent enzyme
Query= SwissProt::P9WP51 (464 letters) >NCBI__GCF_000341125.1:WP_017598874.1 Length = 439 Score = 106 bits (265), Expect = 1e-27 Identities = 95/310 (30%), Positives = 137/310 (44%), Gaps = 18/310 (5%) Query: 6 HISELIGGTPLVRLNSVVPDGAGT-VAAKVEYLNPGGSSKDRIAVKMIEAAEASGQLKPG 64 +I++ IG TPLVR++ V + AK+E LNP GS KDR A M A Q + G Sbjct: 5 NITDAIGDTPLVRIDPAVHGLRNIDLYAKLEMLNPFGSVKDRAAWNMARPDLARAQ-RSG 63 Query: 65 GTIVEPTSGNTGVGLALVAQRRGYKCVFVCPDKVSEDKRNVLIAYGAEVVVCPTAVPPHD 124 T+VE +SGNT LA +A G V + +++L+ GA + P D Sbjct: 64 ATVVELSSGNTAKALAAIAGMHGLPFRSVTNRMRVPEIKDLLLLLGARIEELPGRTECLD 123 Query: 125 PA----SYYSVSDRLVRDIDGAWKPDQYANPEGPASHYVTTGPEIWADTEGKV-THFVAG 179 P + L DQY NP +H TGPEI AD +G+ +FVA Sbjct: 124 PTLTDDPLTLIHQELSAPDSAHLHTDQYFNPRNADAHAAGTGPEIVADLDGRAPEYFVAC 183 Query: 180 IGTGGTITGAGRYLKEVSGGRVRIVGADPEGSVYSGGAGRPYLVEGVGEDFWPAAYDPSV 239 +GT G+ TG R L++ G R++G S + G + + E +DP V Sbjct: 184 VGTAGSSTGVARVLRDHDPG-TRVIGLVGSKSDFIPG------IRTIDEVHEVGLFDPQV 236 Query: 240 PDEIIAVSDSDSFDMTRRLAREEAMLVGGSCGMAVVAALKVAEEAGPD----ALIVVLLP 295 D I VS D+ + L R +L G + G A A++ P A V ++ Sbjct: 237 YDTIEDVSAEDAVEGMLTLVRRCGILSGPTGGAAYFGAVRHLRGVDPTLTGRASAVFIVC 296 Query: 296 DGGRGYMSKI 305 D Y+S + Sbjct: 297 DRCESYLSYV 306 Lambda K H 0.316 0.135 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 511 Number of extensions: 29 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 464 Length of database: 439 Length adjustment: 33 Effective length of query: 431 Effective length of database: 406 Effective search space: 174986 Effective search space used: 174986 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory