Align threonine synthase (EC 4.2.3.1) (characterized)
to candidate WP_017600305.1 D471_RS0120240 cysteine synthase
Query= BRENDA::P83823 (351 letters) >NCBI__GCF_000341125.1:WP_017600305.1 Length = 315 Score = 60.8 bits (146), Expect = 4e-14 Identities = 55/181 (30%), Positives = 85/181 (46%), Gaps = 15/181 (8%) Query: 23 SLLE--GSTPLIPLKGPEEARKKGIRLYAKYEGLNPTGSFKDRGMTLAVSKAVEGGAQAV 80 SLL+ G TPL+ L P + +RL+AK E NPTGS KDR + +A + G + Sbjct: 5 SLLDSLGGTPLVGL--PRLSPSPDVRLWAKLEDRNPTGSIKDRAAFFMIEQAEKDGLLSP 62 Query: 81 ACA----STGNTAASAAAYAARAGILAIVVLPAGYVALGKVAQSLVHGARI--VQVEGNF 134 C ++GNT S A A G + V+P A K S+ GA + G Sbjct: 63 GCTILEPTSGNTGISLAMVAKLRGYRMVCVMPENTSAERKQLLSM-WGAEVHFSDAAGGS 121 Query: 135 DDALRLTQKLTEAFP--VALVNSVNPHRLEGQ-KTLAFEVVDELGDAPHYHALPVGNAGN 191 ++A+R+ +++ A P V L NP +T E++ +L + H+ A +G G Sbjct: 122 NEAVRVAKEMARANPDWVMLYQYGNPANARAHYETTGPEILADLPEITHFVA-GLGTTGT 180 Query: 192 I 192 + Sbjct: 181 L 181 Lambda K H 0.317 0.134 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 241 Number of extensions: 16 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 351 Length of database: 315 Length adjustment: 28 Effective length of query: 323 Effective length of database: 287 Effective search space: 92701 Effective search space used: 92701 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory