Align acetylglutamate kinase (EC 2.7.2.8) (characterized)
to candidate WP_018233349.1 THITHI_RS0112025 acetylglutamate kinase
Query= BRENDA::Q9HTN2 (301 letters) >NCBI__GCF_000378965.1:WP_018233349.1 Length = 295 Score = 401 bits (1030), Expect = e-116 Identities = 199/293 (67%), Positives = 245/293 (83%) Query: 3 LSRDDAAQVAKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINP 62 ++++ A+QVA+VL+EALPYI+RF GKT+VIKYGGNAM + LK GFARD+VL+K VG+NP Sbjct: 1 MNKESASQVARVLTEALPYIQRFSGKTVVIKYGGNAMVDDALKKGFARDIVLLKQVGLNP 60 Query: 63 VVVHGGGPQIGDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGS 122 VVVHGGGPQIG +L ++ ES F+DG+RVTD+ TMDVV+MVLGG VNKDIV+LIN GG Sbjct: 61 VVVHGGGPQIGKVLAQIGKESRFVDGLRVTDSETMDVVQMVLGGLVNKDIVSLINSFGGR 120 Query: 123 AIGLTGKDAELIRAKKLTVTRQTPEMTKPEIIDIGHVGEVTGVNVGLLNMLVKGDFIPVI 182 A+GLTGKD LI A++L TR PEIID+GHVGEV G++ +++ML GDFIPVI Sbjct: 121 AVGLTGKDGGLIHARRLAHTRPGETADAPEIIDLGHVGEVDGIDPAVVHMLDSGDFIPVI 180 Query: 183 APIGVGSNGESYNINADLVAGKVAEALKAEKLMLLTNIAGLMDKQGQVLTGLSTEQVNEL 242 APIGVG +G +YNINADLVAGK+A L+AEKL+LLTN G+MD QG++LTGL+ QV+EL Sbjct: 181 APIGVGDDGTAYNINADLVAGKMASVLRAEKLILLTNTTGVMDPQGRLLTGLTARQVDEL 240 Query: 243 IADGTIYGGMLPKIRCALEAVQGGVTSAHIIDGRVPNAVLLEIFTDSGVGTLI 295 IADGTI+GGM+PKI CAL+AV+ GV SAHIIDGRV +AVLLE+FTD GVGTLI Sbjct: 241 IADGTIHGGMIPKIGCALDAVKSGVKSAHIIDGRVEHAVLLELFTDEGVGTLI 293 Lambda K H 0.318 0.138 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 368 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 295 Length adjustment: 26 Effective length of query: 275 Effective length of database: 269 Effective search space: 73975 Effective search space used: 73975 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate WP_018233349.1 THITHI_RS0112025 (acetylglutamate kinase)
to HMM TIGR00761 (argB: acetylglutamate kinase (EC 2.7.2.8))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00761.hmm # target sequence database: /tmp/gapView.2102519.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00761 [M=231] Accession: TIGR00761 Description: argB: acetylglutamate kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.8e-76 241.1 3.1 6.9e-76 240.8 3.1 1.0 1 NCBI__GCF_000378965.1:WP_018233349.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000378965.1:WP_018233349.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 240.8 3.1 6.9e-76 6.9e-76 1 231 [] 27 270 .. 27 270 .. 0.98 Alignments for each domain: == domain 1 score: 240.8 bits; conditional E-value: 6.9e-76 TIGR00761 1 tiViKiGGaais..elleelakdiaklrkegiklvivHGGgpeinelleklgievefvnglRvTdketlevve 71 t+ViK+GG+a+ l++ +a+di+ l+++g+++v+vHGGgp+i ++l ++g e +fv+glRvTd et++vv+ NCBI__GCF_000378965.1:WP_018233349.1 27 TVVIKYGGNAMVddALKKGFARDIVLLKQVGLNPVVVHGGGPQIGKVLAQIGKESRFVDGLRVTDSETMDVVQ 99 69*********98789999****************************************************** PP TIGR00761 72 mvligkvnkelvallekhgikavGltgkDgqlltaekldke............dlgyvGeikkvnkelleall 132 mvl g vnk +v l++ g +avGltgkDg l+ a++l + dlg+vGe++ +++++++ l NCBI__GCF_000378965.1:WP_018233349.1 100 MVLGGLVNKDIVSLINSFGGRAVGLTGKDGGLIHARRLAHTrpgetadapeiiDLGHVGEVDGIDPAVVHMLD 172 ************************************999988999**************************** PP TIGR00761 133 kagiipviaslaldeegqllNvnaDtaAaelAaaleAekLvlLtdvaGilegdkksliseleleeieqlikqa 205 ++ipvia++++ ++g+++N+naD +A+++A++l AekL+lLt++ G+++ + +l++ l+++++++li + NCBI__GCF_000378965.1:WP_018233349.1 173 SGDFIPVIAPIGVGDDGTAYNINADLVAGKMASVLRAEKLILLTNTTGVMDP-QGRLLTGLTARQVDELIADG 244 ****************************************************.666***************** PP TIGR00761 206 vikgGmipKveaalealesgvkkvvi 231 i+gGmipK+ +al+a++sgvk+++i NCBI__GCF_000378965.1:WP_018233349.1 245 TIHGGMIPKIGCALDAVKSGVKSAHI 270 ************************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (231 nodes) Target sequences: 1 (295 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 13.30 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory