Align ATP phosphoribosyltransferase (EC 2.4.2.17) (characterized)
to candidate WP_018232415.1 THITHI_RS0107250 ATP phosphoribosyltransferase
Query= reanno::pseudo5_N2C3_1:AO356_06970 (211 letters) >NCBI__GCF_000378965.1:WP_018232415.1 Length = 216 Score = 288 bits (738), Expect = 4e-83 Identities = 143/205 (69%), Positives = 176/205 (85%) Query: 2 LTIALSKGRILDDTLPLLAEAGIVPTENPDKSRKLIIPTTQADVRLLIVRATDVPTYVEH 61 LTIALSKGRI DTLPLLA AGI P ++P+ SRKLI+ T +V+L+++RA DVPTYV++ Sbjct: 6 LTIALSKGRIYKDTLPLLAAAGITPVDDPETSRKLILDTNLPEVKLVVIRAADVPTYVQY 65 Query: 62 GAADLGVAGKDVLMEYGGQGLYEPLDLRIARCKLMTAGKVGAPEPKGRLRVATKFVNIAK 121 GAADLGV+GKDVLME+GG+G+YEPLDLRIARC+LM AG+ GA E GRLRVATKFVN + Sbjct: 66 GAADLGVSGKDVLMEHGGEGIYEPLDLRIARCRLMVAGRPGATETAGRLRVATKFVNTTR 125 Query: 122 RYYAEQGRQVDIIKLYGSMELAPLIGLADKIIDVVDTGNTLRANGLEPQDFIADITSRLI 181 +YA QGRQV+IIKLYGSMELAP++GL+D I+D+VDTGNTLRANGL P + IADI++RL+ Sbjct: 126 HHYAAQGRQVEIIKLYGSMELAPIVGLSDCIVDLVDTGNTLRANGLVPLEHIADISARLV 185 Query: 182 VNKASMKMQHARIQALIDTLRKAVE 206 VNKASMKM+ AR++ LI L +AVE Sbjct: 186 VNKASMKMKSARVKDLIRLLGEAVE 210 Lambda K H 0.320 0.138 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 229 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 211 Length of database: 216 Length adjustment: 22 Effective length of query: 189 Effective length of database: 194 Effective search space: 36666 Effective search space used: 36666 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 45 (21.9 bits)
Align candidate WP_018232415.1 THITHI_RS0107250 (ATP phosphoribosyltransferase)
to HMM TIGR00070 (hisG: ATP phosphoribosyltransferase (EC 2.4.2.17))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00070.hmm # target sequence database: /tmp/gapView.152233.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00070 [M=183] Accession: TIGR00070 Description: hisG: ATP phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-59 186.9 0.0 2e-59 186.6 0.0 1.1 1 NCBI__GCF_000378965.1:WP_018232415.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000378965.1:WP_018232415.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 186.6 0.0 2e-59 2e-59 1 183 [] 6 186 .. 6 186 .. 0.94 Alignments for each domain: == domain 1 score: 186.6 bits; conditional E-value: 2e-59 TIGR00070 1 lriAlpKGrleeetlkllekaglklskke..erkliasaedeevevlllrakdiptyvekgaadlGitGkDll 71 l+iAl KGr+ ++tl ll++ag++ + +rkli +++ +ev+++++ra+d+ptyv++gaadlG++GkD+l NCBI__GCF_000378965.1:WP_018232415.1 6 LTIALSKGRIYKDTLPLLAAAGITPVDDPetSRKLILDTNLPEVKLVVIRAADVPTYVQYGAADLGVSGKDVL 78 79*********************966655589***************************************** PP TIGR00070 72 eEsead.vvelldlgfgkcklvlAvpeesdvesledlkegk.riATkypnltreylekkgvkveivkleGavE 142 +E++ + ++e ldl++ +c+l++A + + + + g+ r+ATk++n+tr++++ +g +vei+kl+G++E NCBI__GCF_000378965.1:WP_018232415.1 79 MEHGGEgIYEPLDLRIARCRLMVAGRPGATET-----A-GRlRVATKFVNTTRHHYAAQGRQVEIIKLYGSME 145 **88777*******************999333.....3.566******************************* PP TIGR00070 143 lapllgladaIvDivetGttLrengLkiieeilessarlia 183 lap++gl+d+IvD+v tG+tLr+ngL+ +e+i ++sarl++ NCBI__GCF_000378965.1:WP_018232415.1 146 LAPIVGLSDCIVDLVDTGNTLRANGLVPLEHIADISARLVV 186 ***************************************85 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (183 nodes) Target sequences: 1 (216 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 11.88 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory