GapMind for Amino acid biosynthesis

 

Alignments for a candidate for hisI in Thioalkalivibrio thiocyanodenitrificans ARhD 1

Align phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31) (characterized)
to candidate WP_018233371.1 THITHI_RS0112135 phosphoribosyl-ATP diphosphatase

Query= reanno::Marino:GFF3253
         (109 letters)



>NCBI__GCF_000378965.1:WP_018233371.1
          Length = 109

 Score =  122 bits (306), Expect = 1e-33
 Identities = 61/104 (58%), Positives = 81/104 (77%), Gaps = 4/104 (3%)

Query: 4   VLENLARVLEARKEADPETSYVASLHAKGLNKILEKVGEECTETLLAAKDAEHSGETRDV 63
           +L+ LARVLE+RK+A P++SYVA L+AKGL+ IL+KVGEE TET++AAK    +G    +
Sbjct: 6   ILDELARVLESRKQAPPDSSYVAGLYAKGLDAILKKVGEEATETVVAAK----NGNREQL 61

Query: 64  VYETADLWFHSMVMLSRLGLGPKDILDELASRFDLSGLEEKASR 107
           V+ETADLWFH +VML+  GLGP  +L EL  RF +SG++EKA R
Sbjct: 62  VHETADLWFHCLVMLAHQGLGPDAVLAELGRRFGVSGIDEKAGR 105


Lambda     K      H
   0.312    0.129    0.352 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 57
Number of extensions: 3
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 109
Length of database: 109
Length adjustment: 12
Effective length of query: 97
Effective length of database: 97
Effective search space:     9409
Effective search space used:     9409
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (20.9 bits)
S2: 40 (20.0 bits)

Align candidate WP_018233371.1 THITHI_RS0112135 (phosphoribosyl-ATP diphosphatase)
to HMM TIGR03188 (hisE: phosphoribosyl-ATP diphosphatase (EC 3.6.1.31))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR03188.hmm
# target sequence database:        /tmp/gapView.1060029.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR03188  [M=84]
Accession:   TIGR03188
Description: histidine_hisI: phosphoribosyl-ATP diphosphatase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                             Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                             -----------
    4.4e-37  112.5   0.0    5.2e-37  112.2   0.0    1.1  1  NCBI__GCF_000378965.1:WP_018233371.1  


Domain annotation for each sequence (and alignments):
>> NCBI__GCF_000378965.1:WP_018233371.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  112.2   0.0   5.2e-37   5.2e-37       1      84 []       7      90 ..       7      90 .. 0.99

  Alignments for each domain:
  == domain 1  score: 112.2 bits;  conditional E-value: 5.2e-37
                             TIGR03188  1 leeLeevieerkeedpeeSytakllekgedkilkKvgEEavEviiaaknedkeelveEaaDllYhllVllaekgv 75
                                          l+eL++v+e+rk+++p++Sy+a l++kg d+ilkKvgEEa+E+++aakn+++e+lv+E+aDl++h+lV+la++g+
  NCBI__GCF_000378965.1:WP_018233371.1  7 LDELARVLESRKQAPPDSSYVAGLYAKGLDAILKKVGEEATETVVAAKNGNREQLVHETADLWFHCLVMLAHQGL 81
                                          789************************************************************************ PP

                             TIGR03188 76 sledvlaeL 84
                                           +++vlaeL
  NCBI__GCF_000378965.1:WP_018233371.1 82 GPDAVLAEL 90
                                          *******98 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (84 nodes)
Target sequences:                          1  (109 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00
# Mc/sec: 4.87
//
[ok]

This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory