Align Putative [LysW]-aminoadipate/[LysW]-glutamate kinase; EC 2.7.2.17; EC 2.7.2.19 (uncharacterized)
to candidate WP_018233349.1 THITHI_RS0112025 acetylglutamate kinase
Query= curated2:A9A1K7 (267 letters) >NCBI__GCF_000378965.1:WP_018233349.1 Length = 295 Score = 113 bits (283), Expect = 4e-30 Identities = 76/257 (29%), Positives = 133/257 (51%), Gaps = 11/257 (4%) Query: 2 ITIKIGGS-VVDDLHPSTIADIKKIAESEGV--ILVHGGGKEVTKVCEQLGKEPKFVTSP 58 + IK GG+ +VDD A + + G+ ++VHGGG ++ KV Q+GKE +FV Sbjct: 28 VVIKYGGNAMVDDALKKGFARDIVLLKQVGLNPVVVHGGGPQIGKVLAQIGKESRFVDG- 86 Query: 59 SGIKSRYTDKETAEIFTMVMSGRINKTIVQMLQKNGINAIGLSGVDAKVIEADRKKKLLI 118 R TD ET ++ MV+ G +NK IV ++ G A+GL+G D +I A R Sbjct: 87 ----LRVTDSETMDVVQMVLGGLVNKDIVSLINSFGGRAVGLTGKDGGLIHARRLAHTRP 142 Query: 119 VNEKGRKQAIDGGYTGKIREVNASFIKSLLDQGLTPVISPIAISEESEFLNVDGDRAAAY 178 + ID G+ G++ ++ + + L PVI+PI + ++ N++ D A Sbjct: 143 GETADAPEIIDLGHVGEVDGIDPAVVHMLDSGDFIPVIAPIGVGDDGTAYNINADLVAGK 202 Query: 179 VAGKVGSDKVLFITNVDGLL-MDDKVVPKLTLAEAKEI--RPKIGPGMEKKILASTEALD 235 +A + ++K++ +TN G++ +++ LT + E+ I GM KI + +A+ Sbjct: 203 MASVLRAEKLILLTNTTGVMDPQGRLLTGLTARQVDELIADGTIHGGMIPKIGCALDAVK 262 Query: 236 MGVTTALIANGQKENPI 252 GV +A I +G+ E+ + Sbjct: 263 SGVKSAHIIDGRVEHAV 279 Lambda K H 0.313 0.133 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 247 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 295 Length adjustment: 26 Effective length of query: 241 Effective length of database: 269 Effective search space: 64829 Effective search space used: 64829 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory