Align Probable methanogen homoaconitase large subunit; HACN; EC 4.2.1.114; Homoaconitate hydratase (uncharacterized)
to candidate WP_019555900.1 F612_RS0101120 3-isopropylmalate dehydratase large subunit
Query= curated2:Q8PZT3 (391 letters) >NCBI__GCF_000381085.1:WP_019555900.1 Length = 471 Score = 221 bits (564), Expect = 3e-62 Identities = 136/363 (37%), Positives = 189/363 (52%), Gaps = 45/363 (12%) Query: 72 EIGEGICHQVLPENGFALPGKLLVGADSHSCTYGAFGAFATGVGATDMAEIFATGKLWFK 131 +I +GI H V PE+G LPG +V DSH+ T+GA GA A G+G +++ + AT L K Sbjct: 106 DIRQGIVHVVGPESGATLPGMTVVCGDSHTATHGALGALAHGIGTSEVEHVLATQCLIQK 165 Query: 132 VPESFRMTVEGSLDKHVYAKDLTLYLIGKTGIAGATYKAVEFYGQAISELSVAGRMTLCN 191 ++ + V+G L V KD+ L +IGK G AG A+EF GQ ++S+ GRMT+CN Sbjct: 166 KMKNMLVKVDGKLSAGVTPKDVVLAIIGKIGTAGGNGHAIEFGGQVFRDMSIEGRMTVCN 225 Query: 192 MAIEMGAKTGIVPPDEKTFDFLKNRAVAP-----------YEPVYSDPDASYLKEFVYDA 240 MAIE GA+ G++ DEKT +++K R AP + + SD DA + D Sbjct: 226 MAIEGGARVGLIAVDEKTVEYVKGRTFAPKGEQWDMAVTAWMDLTSDADAVFDTLVELDG 285 Query: 241 GDIEPQV---ACPHQVDNV-----KPVGEVEGTHVD-----------------------Q 269 IEPQV P V +V P E++ D Sbjct: 286 SMIEPQVTWGTSPEMVLDVNGRVPNPANEMDAVKADGIRRALAYMGLEADMAIKDIPAEY 345 Query: 270 VFIGTCTNGRLEDLEVAASVLKGKKVTVR---TIIIPASRSTLLAAIKNGTMEILLKAGV 326 VFIG+CTN R+EDL AA+VLKG+K++ + + +P S A G +I ++AG Sbjct: 346 VFIGSCTNSRIEDLRAAATVLKGRKISDKVELALAVPGSGLVKQQAEAEGLDKIFIEAGF 405 Query: 327 TLATPGCGPCLGAHQGVLGEGEVCVSTANRNFKGRMGKDGFIYLASPATAAASALTGEIT 386 PGC CL + L G+ C ST+NRNF+GR G G +L SP AAA+A+ G Sbjct: 406 EWRNPGCSMCLAMNADKLPTGKHCASTSNRNFEGRQGAGGRTHLVSPEMAAAAAIAGHFV 465 Query: 387 DPR 389 D R Sbjct: 466 DVR 468 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 428 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 391 Length of database: 471 Length adjustment: 32 Effective length of query: 359 Effective length of database: 439 Effective search space: 157601 Effective search space used: 157601 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory