Align Probable N-acetyl-LL-diaminopimelate aminotransferase; Putative aminotransferase A; EC 2.6.1.- (characterized)
to candidate WP_028485150.1 A377_RS0100845 pyridoxal phosphate-dependent aminotransferase
Query= SwissProt::P16524 (393 letters) >NCBI__GCF_000384235.1:WP_028485150.1 Length = 393 Score = 227 bits (578), Expect = 5e-64 Identities = 138/373 (36%), Positives = 216/373 (57%), Gaps = 15/373 (4%) Query: 19 KFSNLVAQHEDVISLTIGQPDFFTPHHVKAAAKKAIDENVTSYTPNAGYLELRQAVQLYM 78 K + L +DVISL G+PDF TP H+KAA +AI+ T YT G EL++A+ Sbjct: 22 KAAELKRAGKDVISLGAGEPDFDTPDHIKAAGIRAIENGQTRYTAVDGTPELKEAIMAKF 81 Query: 79 KKKADFNYDAESEIIITTGASQAIDAAFRTILSPGDEVIMPGPIYPGYEPIINLCGAKPV 138 K+ +Y + EI++++G Q+ + +L+ GDEVI+P P + Y + L G KPV Sbjct: 82 KRDNGIDYQMD-EILVSSGGKQSFYNLCQGLLNDGDEVIIPAPYWVSYPDMALLAGGKPV 140 Query: 139 IVDT-TSHGFKLTARLIEDALTPNTKCVVLPYPSNPTGVTLSEEELKSIAALLKGR-NVF 196 +++T +K+TA ++ A+T T+ +V+ PSNP+G S +EL +I A+L + Sbjct: 141 VLETGIEQRYKITAEQLKAAITDKTRMMVINSPSNPSGAVYSRDELAAIGAVLAQHPEIV 200 Query: 197 VLSDEIYSELTYDRPHYS----IATYLRDQTIVINGLSKSHSMTGWRIGFLFAPKDIAKH 252 + SD++Y + ++ + L+D+T+V+NG+SK+++MTGWRIG+ PKD+ Sbjct: 201 IASDDMYEHIILGETPFTNILQVCPELKDRTVVMNGVSKAYAMTGWRIGYAGGPKDLIGA 260 Query: 253 ILKVHQYNVSCASSISQKAALEAVTNGFDDALIMREQYKKRLDYVYDRLVSM-GLDVVKP 311 + KV + S SISQ A++EA+ D M +K+R D+V + + G+ + Sbjct: 261 MRKVQSQSTSNPCSISQAASVEALNGPQDCIDTMVTAFKQRHDFVLETANRIPGIQSIPA 320 Query: 312 SGAFYIF----PSIKSFGM-TSFDFSMALLEDAGVALVPGSSFSTYGEGYVRLSFACSMD 366 +GAFY F ++K GM DF+ ALLE VA VPGS F GY+R+SFA S+D Sbjct: 321 AGAFYAFLDVREAMKIKGMEKDADFATALLEQQEVAAVPGSGFG--APGYLRISFATSLD 378 Query: 367 TLREGLDRLELFV 379 L+E L RL+ F+ Sbjct: 379 HLKEALKRLKTFM 391 Lambda K H 0.319 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 332 Number of extensions: 26 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 393 Length adjustment: 31 Effective length of query: 362 Effective length of database: 362 Effective search space: 131044 Effective search space used: 131044 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory