Align [amino group carrier protein]-gamma-(L-lysyl)-L-glutamate aminotransferase (EC 2.6.1.118) (characterized)
to candidate WP_019895362.1 A377_RS0106195 diaminobutyrate--2-oxoglutarate transaminase
Query= BRENDA::Q93R93 (395 letters) >NCBI__GCF_000384235.1:WP_019895362.1 Length = 417 Score = 192 bits (489), Expect = 1e-53 Identities = 141/414 (34%), Positives = 213/414 (51%), Gaps = 29/414 (7%) Query: 8 DWRALLEAEKTLDSGVYNKHDLLIVRGQGARVWDAEGNEYIDCVGGYGVANLGHGNPEVV 67 DW E+E S Y + V+GQ A+ WD G EYID G GV N GH NP++ Sbjct: 2 DWFEQYESEIRAYSRAY---PAVFVKGQNAKQWDETGKEYIDFYAGAGVLNFGHNNPKLK 58 Query: 68 EAVKRQ-AETLMAMPQTLPTPMRGEFYRTLT-AILPP---ELNRVFPVNSGTEANEAALK 122 A+ AE + + T + +F + IL P + F +GT A EAALK Sbjct: 59 AAMMDYLAEDGVLHSLDMMTAAKRDFIQGFVETILQPRKMDYKLQFMGPTGTNAVEAALK 118 Query: 123 FARAHTGRKKFVAAMRGFSGRTMGSLSVTWEPKYREPFLPLVEPVEFIPYND-------- 174 AR TGR+ +A +GF G T+G+L+ T +R+ + V P+ Sbjct: 119 LARKVTGRQNVIAFAQGFHGMTLGALACTANGYFRQAAGVPLNHVSHCPFETNVGGGLAM 178 Query: 175 VEALKRAVD------EETAAVILEPVQGEGGVRPATPEFLRAAREITQEKGALLILDEIQ 228 ++ L+ D E+ AA+++EP+Q EGGV A+ E+L+ ++ ++ GALLI+D+IQ Sbjct: 179 LDTLRALYDNTSGGAEKPAAILVEPIQAEGGVNVASAEWLQGLDKLAKDLGALLIVDDIQ 238 Query: 229 TGMGRTGKRFAFEHFGIVPDILTLAKALGG-GVPLGVAVMREEVARSMPKGGHGTTFGGN 287 G GRTG+ F+F+ GI PDI+TLAK LGG G P+ + +++ E + G H TF G Sbjct: 239 AGCGRTGQYFSFDEAGIDPDIITLAKGLGGLGTPIAMNLVKPEHDQHWQPGEHTGTFRGQ 298 Query: 288 PLAMAAGVAAIRYLERTRLWERAAELGPWF---MEKLRAIPSPKIREVRGMGLMVGLELK 344 L+ AG A+RY E +L + G +E++ VRG G+M L++ Sbjct: 299 NLSFVAGREALRYFEDDQLMNAVHDKGEIMVGALEQMAQTYPDAGFSVRGKGMMQALDVG 358 Query: 345 EKA-APYIARLEKEHRVL--ALQAGPTVIRFLPPLVIEKEDLERVVEAVRAVLA 395 + A A +AR E +L G +VI+ +PPL I +++L +E + LA Sbjct: 359 DGALAKAVARECFERGMLFGPCGVGGSVIKLIPPLTIPEDELVAGLEILSEALA 412 Lambda K H 0.319 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 388 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 417 Length adjustment: 31 Effective length of query: 364 Effective length of database: 386 Effective search space: 140504 Effective search space used: 140504 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory