Align Bifunctional chorismate mutase/prephenate dehydratase; Chorismate mutase-prephenate dehydratase; P-protein; EC 5.4.99.5; EC 4.2.1.51 (characterized)
to candidate WP_033423190.1 A377_RS0110545 prephenate dehydratase
Query= SwissProt::P27603 (365 letters) >NCBI__GCF_000384235.1:WP_033423190.1 Length = 370 Score = 299 bits (766), Expect = 7e-86 Identities = 162/364 (44%), Positives = 229/364 (62%), Gaps = 3/364 (0%) Query: 2 SEADQLKALRVRIDSLDERILDLISERARCAQEVARVKTASWPKAEEAVFYRPEREAWVL 61 +E +L A+R ID++D I LI RA CAQ+VA +KT EAVFYRPEREA VL Sbjct: 9 TEQIELNAIREEIDAIDADIQTLIGRRAECAQKVADIKTRGGQV--EAVFYRPEREAQVL 66 Query: 62 KHIMELNKGPLDNEEMARLFREIMSSCLALEQPLRVAYLGPEGTFSQAAALKHFGHSVIS 121 + + N + NE+MARLFREIMS CLALEQP++VAYLGPEG++S A LK FG SV Sbjct: 67 RAVKARNHSLIPNEDMARLFREIMSVCLALEQPVKVAYLGPEGSYSHACVLKQFGTSVHP 126 Query: 122 KPMAAIDEVFREVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDIVICGEVELRIHHHLL 181 + +ID VF V V +GVVPVENS+EG V T + ++ + + GEV+L IHH LL Sbjct: 127 YAVPSIDAVFAAVEKKHVQYGVVPVENSSEGVVKQTQKALMDTALKVTGEVDLAIHHCLL 186 Query: 182 VGETTKTDRITRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAAKRVKSEWNSAAIAG 241 + + +I +H Q+L QC +WL + P + V SNA AA+ +++ N AIA Sbjct: 187 -AQNPDPHALKKIVAHPQALGQCEQWLSQNLPGLVTEEVDSNAVAAQMAEADPNVGAIAS 245 Query: 242 DMAAQLYGLSKLAEKIEDRPVNSTRFLIIGSQEVPPTGDDKTSIIVSMRNKPGALHELLM 301 + AA+LYGL L +IED+ N+T+F ++G + P+G DKT++I+S+ N+ G+L +L Sbjct: 246 EEAARLYGLKILETRIEDQKNNTTKFWVLGQEAAGPSGQDKTAMILSVPNQAGSLIRVLD 305 Query: 302 PFHSNGIDLTRIETRPSRSGKWTYVFFIDCMGHHQDPLIKNVLEKIGHEAVALKVLGSYP 361 F I +TRI + PS +W Y+F+ID +GH + P + L ++ + K+LGSYP Sbjct: 306 SFARRRISMTRIISVPSTETRWDYIFYIDILGHREQPEVAEALTEVQAQCSYFKLLGSYP 365 Query: 362 KAVL 365 + L Sbjct: 366 VSPL 369 Lambda K H 0.319 0.133 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 354 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 370 Length adjustment: 30 Effective length of query: 335 Effective length of database: 340 Effective search space: 113900 Effective search space used: 113900 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_033423190.1 A377_RS0110545 (prephenate dehydratase)
to HMM TIGR01807 (pheA: chorismate mutase (EC 5.4.99.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01807.hmm # target sequence database: /tmp/gapView.3097691.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01807 [M=76] Accession: TIGR01807 Description: CM_P2: chorismate mutase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-29 87.5 1.2 7.2e-29 86.2 1.0 1.8 2 NCBI__GCF_000384235.1:WP_033423190.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000384235.1:WP_033423190.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 86.2 1.0 7.2e-29 7.2e-29 1 76 [] 14 90 .. 14 90 .. 0.97 2 ? -2.4 0.0 0.32 0.32 57 72 .. 237 252 .. 227 253 .. 0.77 Alignments for each domain: == domain 1 score: 86.2 bits; conditional E-value: 7.2e-29 TIGR01807 1 LkelRnkiDaiDdrildLlseRaklakavgelKkks.aseaviYRPeREaavlrrlkelnkGpLdqeavarifrE 74 L+++R++iDaiD+ i +L+ Ra++a++v+++K+++ eav+YRPeREa+vlr +k +n+ ++++e++ar+frE NCBI__GCF_000384235.1:WP_033423190.1 14 LNAIREEIDAIDADIQTLIGRRAECAQKVADIKTRGgQVEAVFYRPEREAQVLRAVKARNHSLIPNEDMARLFRE 88 6899******************************996789*********************************** PP TIGR01807 75 im 76 im NCBI__GCF_000384235.1:WP_033423190.1 89 IM 90 *9 PP == domain 2 score: -2.4 bits; conditional E-value: 0.32 TIGR01807 57 elnkGpLdqeavarif 72 + n G + +e+ ar++ NCBI__GCF_000384235.1:WP_033423190.1 237 DPNVGAIASEEAARLY 252 4588999999999998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (76 nodes) Target sequences: 1 (370 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 20.02 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory