Align phosphoribosylanthranilate isomerase (EC 5.3.1.24) (characterized)
to candidate WP_028485338.1 A377_RS0106860 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase
Query= BRENDA::P16250 (240 letters) >NCBI__GCF_000384235.1:WP_028485338.1 Length = 253 Score = 145 bits (365), Expect = 1e-39 Identities = 83/225 (36%), Positives = 127/225 (56%), Gaps = 4/225 (1%) Query: 6 LLPAVDVRDGQAVRLVHGESGTETSYGSPLEA-ALAWQRSGAEWLHLVDLDAAF-GTGDN 63 L+PA+D++DGQ VRL G+ T + + A A W GA LH+VDL+ AF G N Sbjct: 3 LIPAIDLKDGQCVRLRQGDMNDATVFSGDIVAMAQKWTEQGARRLHMVDLNGAFAGKPVN 62 Query: 64 RALIAEVAQAM-DIKVELSGGIRDDDTLAAALATGCTRVNLGTAALETPEWVAKVIAEHG 122 + + +V +A D+ +++ GG+RD T+ A L G + +GT A+ P++V + Sbjct: 63 ASAVYQVREAYPDLPIQIGGGLRDLATIEAYLDAGVSYCIIGTQAVHDPDFVRQACERFP 122 Query: 123 DKIAVGLDVRGTTLRGRGWTRDGGDLYETLD-RLNKEGCARYVVTDIAKDGTLQGPNLEL 181 I VGLD + + GW ETL R +G V TDI +DG +QG N+E Sbjct: 123 GHIIVGLDAKDGKVAINGWAEITDHHVETLGKRFENDGVEAIVYTDIGRDGMMQGVNIEA 182 Query: 182 LKNVCAATDRPVVASGGVSSLDDLRAIAGLVPAGVEGAIVGKALY 226 + + A + P++ASGG+++LDD+RA+A + GV AI G+A+Y Sbjct: 183 TQKLAQALNIPIIASGGITNLDDIRALAQIESDGVTAAITGRAIY 227 Lambda K H 0.315 0.133 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 170 Number of extensions: 14 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 253 Length adjustment: 24 Effective length of query: 216 Effective length of database: 229 Effective search space: 49464 Effective search space used: 49464 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory