Align triose-phosphate isomerase (EC 5.3.1.1) (characterized)
to candidate WP_040580333.1 A3OQ_RS0100850 phosphoglycerate kinase
Query= BRENDA::P36204 (654 letters) >NCBI__GCF_000385335.1:WP_040580333.1 Length = 408 Score = 351 bits (900), Expect = e-101 Identities = 190/391 (48%), Positives = 251/391 (64%), Gaps = 2/391 (0%) Query: 5 TIRDVDLKGKRVIMRVDFNVPVKDGVVQDDTRIRAALPTIKYALEQGAKVILLSHLGRPK 64 T+ +VDLK KRV++RVD NVP++DG + D TRI L I+ E+G KVILLSHLGRPK Sbjct: 6 TLDNVDLKNKRVLVRVDLNVPMEDGRITDVTRIDRILANIREISEKGGKVILLSHLGRPK 65 Query: 65 GEPSPEFSLAPVAKRLSELLGKEVKFVPAVVGDEVKKAVEELKEGEVLLLENTRFHPGET 124 P P SL VA L LG+ V F VGD K AV L G++LLLENTRFH GE Sbjct: 66 NGPDPSTSLKSVAVELERQLGRIVAFSSDCVGDVAKSAVGALHAGDILLLENTRFHKGEV 125 Query: 125 KNDPELAKFWASLADIHVNDAFGTAHRAHASNVGIAQFIPSVAGFLMEKEIKFLSKVTYN 184 +NDP + A L D++VNDAF TAHRAHAS G+A +P+ AG M+ E++ L+ + + Sbjct: 126 QNDPAFVQALAELGDVYVNDAFSTAHRAHASTEGLAHILPAYAGRTMQFELEMLTSMLAH 185 Query: 185 PEKPYVVVLGGAKVSDKIGVITNLMEKADRILIGGAMMFTFLKALGKEVGSSRVEEDKID 244 P +P +GGAKVS K+ ++ NLM K + + IGG M TFL A GK +G S E + D Sbjct: 186 PVRPLAAFVGGAKVSTKLELLGNLMRKVEYLFIGGGMANTFLAASGKAIGKSICEMELAD 245 Query: 245 LAKELLEKAKEKGVEIVLPVDAVIAQKIEPGVEKKVVRIDDGIPEGWMGLDIGPETIELF 304 +A++++ A+ E+VLP DA++AQK+ P V + V I D + E M LDIGP TI Sbjct: 246 VARKIMADAEAAKCELVLPCDAIVAQKLAPDVTVRAVDI-DSVGENDMILDIGPRTISKV 304 Query: 305 KQKLSDAKTVVWNGPMGVFEIDDFAEGTKQVALAIAALTEKGAI-TVVGGGDSAAAVNKF 363 L+ A+T+VWNGP G FE+ F GT VA A LT+ A+ T+ GGGD+ AA+N Sbjct: 305 VGLLASARTLVWNGPFGAFEVAPFDIGTVTVAKVAALLTKVSALETIAGGGDTIAALNVA 364 Query: 364 GLEDKFSHVSTGGGASLEFLEGKELPGIASI 394 G F++VST GGA LE+LEGK LPG+ ++ Sbjct: 365 GAFSSFTYVSTAGGAFLEWLEGKSLPGVEAL 395 Lambda K H 0.317 0.137 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 573 Number of extensions: 27 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 654 Length of database: 408 Length adjustment: 35 Effective length of query: 619 Effective length of database: 373 Effective search space: 230887 Effective search space used: 230887 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory