Align Alanine--glyoxylate aminotransferase 2 homolog 2, mitochondrial; Beta-alanine-pyruvate aminotransferase 2; EC 2.6.1.44 (characterized)
to candidate WP_026595516.1 A3OQ_RS0105180 aspartate aminotransferase family protein
Query= SwissProt::Q94AL9 (477 letters) >NCBI__GCF_000385335.1:WP_026595516.1 Length = 455 Score = 163 bits (413), Expect = 1e-44 Identities = 130/406 (32%), Positives = 195/406 (48%), Gaps = 38/406 (9%) Query: 86 GKMQYLFDESGRRYLDAFAGIAVVNCGHCHPDVVEPVINQIKRLQHPTVLYLNHAIAD-- 143 G+ QYL+D G RYLD +G V G HP V + + P ++ ++ + Sbjct: 37 GRGQYLWDRKGDRYLDLLSGWGVFGLGRNHP-TVRDALKTVLDADLPGLVQMDLPLLAGL 95 Query: 144 FSEALASKLPGDLKVVFFTNSGTEANELALMMAKLYTGCQDIVAVRNGYHGNAAATMGAT 203 +E L +P L VFF NSG+EA E A+ A+ TG IV + +HG + + Sbjct: 96 LAERLLRYVPY-LDKVFFANSGSEAVESAIKFARRATGRSGIVYCDHAFHGLSYGALALN 154 Query: 204 GQSMWKFNVVQNSVHHALNPDPYRGVFGSDGEKYAKDLQDLIQYGTTGHIAGFICEAIQG 263 G + ++ L PD + F DL L + T IAGFI E IQG Sbjct: 155 GDNTFREGF------GPLLPDCHEIPFN--------DLAALEKALRTRQIAGFIVEPIQG 200 Query: 264 VGGIVELAPG-YLSAAYDTVKKAGGLFIADEVQSGFARTGNFWGFEAHNVVPDIVTMAKG 322 G V + YL A +K G LFIADE+Q+G RTG F E NV PD+V +AK Sbjct: 201 KG--VNMPDDLYLRGAQALCRKYGTLFIADEIQTGMGRTGRFLAVEHWNVEPDMVLLAKT 258 Query: 323 IGNGF-PLGAVVTTPEIAG-VLTRRS----YFNTFGGNSVSTTAGLAVLNVIEKEKLQEN 376 + G P+GAV+T + V TR + +TF N ++ AGLA L VIE+E+L +N Sbjct: 259 LSGGHVPVGAVLTRKAVFDKVFTRMDKAVVHGSTFAKNDLAMAAGLATLEVIEQERLIQN 318 Query: 377 AAMVGSYLKEKLTQLKEKHEIIGDVRGRGLMLGVELVSDRKLKTPATAETLHIMDQ---- 432 AA G+ L + ++E++ VRG+GLM+G+E + LK A+ L + Sbjct: 319 AAKTGARLLAAFEAMVPRYELLKAVRGKGLMIGIEFGPPKSLKLKASWTLLEAANAGLFC 378 Query: 433 -------MKELGVLIGKGGYFGNVFRITPPLCFTKDDADFLVEAMD 471 K+ +L G+ + ++ P + T D D++ ++ + Sbjct: 379 QLITVPLFKDHKILAQVAGHGIHTIKLLPAMILTDTDCDWIEQSFE 424 Lambda K H 0.320 0.136 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 468 Number of extensions: 22 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 477 Length of database: 455 Length adjustment: 33 Effective length of query: 444 Effective length of database: 422 Effective search space: 187368 Effective search space used: 187368 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory