Align Serine hydroxymethyltransferase; SHMT; Serine methylase; L-threonine/L-allo-threonine aldolase; EC 2.1.2.1; EC 4.1.2.48 (characterized)
to candidate WP_020176284.1 A3OQ_RS0115295 serine hydroxymethyltransferase
Query= SwissProt::D3DKC4 (427 letters) >NCBI__GCF_000385335.1:WP_020176284.1 Length = 433 Score = 477 bits (1227), Expect = e-139 Identities = 243/414 (58%), Positives = 306/414 (73%), Gaps = 7/414 (1%) Query: 4 LFNTDAEIYEAIVKEYERQFYHLELIASENFTSLAVMEAQGSVMTNKYAEGLPHKRYYGG 63 L D E+ AI +E RQ +ELIASEN S AV+EAQGSV+TNKYAEG P +RYYGG Sbjct: 20 LAEADPEVAAAIAQELGRQRDEIELIASENIVSKAVLEAQGSVLTNKYAEGYPGRRYYGG 79 Query: 64 CEFVDIAEDLAIERAKALFDAEHANVQPHSGTQANMAVYMAVLKPGDTIMGMDLSHGGHL 123 C+FVDIAE+LAIER K LFD ANVQP+SG+QAN AV++A+L+PGDT +G+DL+ GGHL Sbjct: 80 CQFVDIAENLAIERVKRLFDCGFANVQPNSGSQANQAVFLALLQPGDTFLGLDLAAGGHL 139 Query: 124 THGAKVNFSGKIYNAVYYGVHPETHLIDYDQLYRLAKEHKPKLIVGGASAYPRVIDWAKL 183 THG+ VN SGK + V YGV + HLID ++L LA EHKPK+I+ G SAYPR D+AK Sbjct: 140 THGSPVNMSGKWFKPVSYGVRQDDHLIDMEKLAELALEHKPKMIIAGGSAYPRFWDFAKF 199 Query: 184 REIADSVGAYLMVDMAHYAGLIAGGVYPNPVPYAHFVTSTTHKTLRGPRSGFILCK-KEF 242 REIADSVGA MVDMAH+AGL+AGGV+P+P P+AH VTSTTHKTLRGPR G +L ++ Sbjct: 200 REIADSVGAIFMVDMAHFAGLVAGGVHPSPFPHAHVVTSTTHKTLRGPRGGLVLTNDQDI 259 Query: 243 AKDIDKSVFPGIQGGPLMHVIAAKAVAFKEAMSQEFKEYARQVVANARVLAEEFIKEGFK 302 AK I+ +VFPG+QGGPLMHVIA KAVAF EA+ FK YARQVV NA+ LA ++ GF Sbjct: 260 AKKINSAVFPGLQGGPLMHVIAGKAVAFGEALQPSFKIYARQVVENAKALASSILEGGFD 319 Query: 303 VVSGGTDSHIVLLDLRDTGLTGREVEEALGKANITVNKNAVPFDPLPPVKTSGIRLGTPA 362 + S GTD+H++L+DLR LTG+ E ALG+A+IT NKN VPFD P+ TSGIRLG PA Sbjct: 320 LASKGTDNHLMLVDLRPKNLTGKAAEAALGRAHITCNKNGVPFDTASPMVTSGIRLGAPA 379 Query: 363 MTTRGMKEDQMRIIARLISKVIKNI---GDEK---VIEYVRQEVIEMCEQFPLY 410 T+RG + + + LI +++ + GDEK V V+ +V + ++FP+Y Sbjct: 380 ATSRGFGIAEFKKVGELIVELLDGLAKNGDEKNGAVEAKVKADVAGLTQRFPIY 433 Lambda K H 0.319 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 608 Number of extensions: 24 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 427 Length of database: 433 Length adjustment: 32 Effective length of query: 395 Effective length of database: 401 Effective search space: 158395 Effective search space used: 158395 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory