Align O-succinylhomoserine sulfhydrylase (EC 2.5.1.48) (characterized)
to candidate WP_020175871.1 A3OQ_RS0113185 O-acetylhomoserine aminocarboxypropyltransferase
Query= reanno::HerbieS:HSERO_RS16440 (413 letters) >NCBI__GCF_000385335.1:WP_020175871.1 Length = 429 Score = 240 bits (613), Expect = 5e-68 Identities = 153/423 (36%), Positives = 224/423 (52%), Gaps = 24/423 (5%) Query: 8 GFTTTILHSDRQKGIEHGSLHKPIHTSVTFGYEDARQLAEVFQGKQPGYRYGRQGNPTVA 67 GF T +H+ + G+ PI+ + +F +ED A +F + G Y R NPT A Sbjct: 9 GFATQAVHAGARPDPTTGARATPIYQTTSFVFEDVDHAAALFGLQAFGNIYTRITNPTNA 68 Query: 68 ALEDKITKMEDGKSTICFATGMAAIGAIVQGLLREGDHVVSSAFLFGNT-NSLWMTVGAQ 126 LE++I +E G + + A+G AA + LL GD +V++ L+G + N L Sbjct: 69 VLEERIAALEGGTAGLAVASGHAAQLLVFHTLLEPGDEIVAATKLYGGSINQLNHAFKKF 128 Query: 127 GAKVSMVDATDVKNVEAAITANTRLVFVETIANPRTQVADLKRIGELCRERGILYVVDNT 186 G V D D+ + AAIT T+ +F+E+IANP V D++ I + E+ + VVDNT Sbjct: 129 GWGVKWADPDDLPSFAAAITPKTKAIFIESIANPGGVVTDIEAIAAIAHEKHLPLVVDNT 188 Query: 187 MTSPYLFRPKTVGAGLVVNSLTKSIGGHGNALGGALTDTGEFDW---TRYPHIAENYKKN 243 + +PYL RP GA ++V+S TK +GGHGN++GG + D G FDW RYP ++ Sbjct: 189 LATPYLVRPFEHGADIIVHSATKFLGGHGNSIGGLIVDGGTFDWMADQRYPSLSA----- 243 Query: 244 PAPQWG-------------MAQIRAKALRDFGGSLGPEAAHHIAVGAETIALRQERECKN 290 P P++G R LRD G +L P A I G ET+ LR +R +N Sbjct: 244 PRPEYGGMVLGEVFGNFAFAIAARVLGLRDLGPALSPFNAFLILTGIETLPLRMQRHSEN 303 Query: 291 ALALAQMLQADERVAAVYYPGLESHPQHALSKALF-RSFGSLMSFELKDGIDC-FDYLNR 348 ALA+A+ L V V YPGL H L+K G++ +F LK G D + R Sbjct: 304 ALAVAEHLAQHNAVNWVSYPGLSGDRYHNLAKKYCPAGAGAVFTFGLKGGYDSGIALVKR 363 Query: 349 LRLAIPTSNLGDTRTLVIPVAHTIFYEMGAERRASMGIAESLIRVSVGLEDTDDLVADFR 408 L+L +N+GDTR+LVI A T ++ +++ G ++R+SVG+ED DL+AD Sbjct: 364 LKLFSHLANVGDTRSLVIHPASTTHRQLADDQKILAGAGPDVVRLSVGIEDKADLIADLD 423 Query: 409 QAL 411 QAL Sbjct: 424 QAL 426 Lambda K H 0.319 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 496 Number of extensions: 26 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 413 Length of database: 429 Length adjustment: 32 Effective length of query: 381 Effective length of database: 397 Effective search space: 151257 Effective search space used: 151257 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory