Align 3-isopropylmalate dehydratase large subunit 2; EC 4.2.1.33; Alpha-IPM isomerase 2; IPMI 2; Isopropylmalate isomerase 2 (uncharacterized)
to candidate WP_022670936.1 G415_RS0106920 aconitate hydratase
Query= curated2:O28084 (416 letters) >NCBI__GCF_000420385.1:WP_022670936.1 Length = 663 Score = 289 bits (739), Expect = 2e-82 Identities = 165/415 (39%), Positives = 233/415 (56%), Gaps = 2/415 (0%) Query: 1 MGKTIAEKILSEKS-KSDAYAGDIVVAEIDQIALQDGTAPLAIRQLMELGTEVRAADRTH 59 MG T+A+KIL E D ++GD + +IDQ QD T +A Q ++G + + + Sbjct: 1 MGLTVAQKILKEHLVDGDLFSGDEIGIKIDQTLTQDATGTMADLQFEQMGVDRVKTEISV 60 Query: 60 FFVDHAAPSPRRELSNDQKFIYEFAKKVGADFNPPGEGIIHQIMVERYVKPGDLAVGADS 119 ++DH E ++D ++ FAKK G + G GI HQ+ +ER +PG +G+DS Sbjct: 61 SYIDHKTIQMGFEDADDHTYLQTFAKKYGLYLSKAGNGICHQVHIERIGRPGATLLGSDS 120 Query: 120 HTCTYGGIGAFSTGMGSTDVAVAIALGKNWFRVPESFRVQLDGSLPKGVFAKDVILKLIG 179 HT T GGIG + G G DVA A+A + P+ V+L G L V AKDVILKL+ Sbjct: 121 HTPTGGGIGMIAIGAGGLDVASAMAGMPFYLPRPKILGVKLTGKLRPWVTAKDVILKLLQ 180 Query: 180 DLGVDGATYKALEFHGECAENMTVEERLTIANMAVECGAKAGIFESDENTRKFLAELGRE 239 L G +E+ GE + +TV ER TI NM E G +F SDE T++FL GR Sbjct: 181 ILSTKGNVGWIVEYFGEGVKTLTVPERGTITNMGAELGVTTSVFPSDEQTKRFLEAQGRG 240 Query: 240 GDFREVKADEDAEYEKEIYMDVSSLVPVVSKPHNVDNVAEISEVEGTEVNQVYIGTCTNG 299 + ++AD DA Y++ I +++S L P++++PHN DNV + E+EGT V+QV IG+CTN Sbjct: 241 DQWIPLEADPDANYDRIIEINLSELEPMIAQPHNPDNVVTVREIEGTPVDQVMIGSCTNS 300 Query: 300 RLSDLEVAARILKGRKVKEGVRLIVVPASRRVYLQALDKGLIRVFVEAGGMVLNPGCGPC 359 D + A I+KGR V V P S++V D+G + + AG +L CG C Sbjct: 301 SYKDGKTVAEIVKGRTVNPNVSCGYAPGSKQVLRMLADEGELSHIIAAGFRILESACGFC 360 Query: 360 VGIHQGILADGEVCISTQNRNFKGRMGNPNAEIFLASPATAAASAVKGYIADPRE 414 +G Q + + I T NRNF GR G A+I+L SP TAAA A+ G I DPR+ Sbjct: 361 IGAGQA-PRNNAISIRTNNRNFYGRSGTVTAKIYLVSPETAAACALTGVITDPRD 414 Lambda K H 0.318 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 684 Number of extensions: 36 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 416 Length of database: 663 Length adjustment: 35 Effective length of query: 381 Effective length of database: 628 Effective search space: 239268 Effective search space used: 239268 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory