Align LL-diaminopimelate aminotransferase; DAP-AT; DAP-aminotransferase; LL-DAP-aminotransferase; EC 2.6.1.83 (characterized)
to candidate WP_022670427.1 G415_RS0104595 pyridoxal phosphate-dependent aminotransferase
Query= SwissProt::Q2RK33 (390 letters) >NCBI__GCF_000420385.1:WP_022670427.1 Length = 400 Score = 195 bits (495), Expect = 2e-54 Identities = 126/401 (31%), Positives = 207/401 (51%), Gaps = 24/401 (5%) Query: 5 RRIRELPPYLFARIEKKIAEARERGVDIISLGIGDPDMPTPSHVIDKLVAEAHNPENH-R 63 RRI + P + I K E R GV++I+ G+PD TP ++ K+ A + + Sbjct: 8 RRIGLIQPSMTIGISAKAKELRAAGVNVINFSAGEPDFDTPDNI--KMAAVKSIADGFTK 65 Query: 64 YPTSEGLLAFRQAVADWYQRLYGVDLDPRREVVTLIGSKEGIAHISLCYVDPGDINLVPD 123 Y + G+ R AV + + G++ R V +G+K + +I+ ++ GD ++ Sbjct: 66 YTAAGGINELRDAVVEKEKNKNGLEYK-RENVCISVGAKHALFNIAAVMLEEGDEVIIIA 124 Query: 124 PGYPVYNIGTLLAGGESYFMPLTAANGFLPDLGAIPSDVARRAKLMFINYPNNPTGA--- 180 P + Y GG++ + T NGF+P + + + K++++N P NPTGA Sbjct: 125 PYWVTYEAIVSYVGGKAVIVNTTEENGFVPTKEQLEKAITPKTKMIWVNNPTNPTGATYT 184 Query: 181 VADLKFFQEVVEFARSYDLIVCHDAAYSEITYDGYRAPSFLQAPG-AKEVGIEFNSVSKP 239 V DLKF +VE A D+ + D Y +I +DGY+ S A E + N VSK Sbjct: 185 VDDLKF---IVELAEKNDIWLVSDEIYEDIVFDGYKPVSMATLSDYAYERTLVVNGVSKT 241 Query: 240 YNMTGWRLGWACGRADVIEALARIKSNIDSGAFQAVQYAGIAALTGPQEGLAEVRRVYQE 299 Y+MTGWR+G+ CG A+VI A+ +++S S Q A + ALTG Q+ + ++R +++ Sbjct: 242 YSMTGWRIGYTCGDAEVIGAMIKLQSQSTSNPTSIAQCAALEALTGDQDSVEKMRVQFEK 301 Query: 300 RRDIIVEGFNSL-GWHLEKPKATFYVWAPVPRGY----------TSASFAEMVLEKAGVI 348 RRD IV+ NS+ G KPK FYV+ + + S FAE++LE V Sbjct: 302 RRDYIVDALNSIEGISCFKPKGAFYVFPNISSFFGKEYEGKKINGSMDFAELLLEHHHVA 361 Query: 349 ITPGNGYGNYGEGYFRIALTISKERMQEAIERLRRVLGKVE 389 + PG +G+ + + R++ S E +QE I+RL+ + K++ Sbjct: 362 VVPGIAFGD--DRFLRMSFATSLEDIQEGIKRLKEFVEKIK 400 Lambda K H 0.320 0.139 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 361 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 390 Length of database: 400 Length adjustment: 31 Effective length of query: 359 Effective length of database: 369 Effective search space: 132471 Effective search space used: 132471 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory