Align Methanogen homoaconitase small subunit; HACN; Homoaconitate hydratase; EC 4.2.1.114 (characterized)
to candidate WP_022670936.1 G415_RS0106920 aconitate hydratase
Query= SwissProt::Q58667 (170 letters) >NCBI__GCF_000420385.1:WP_022670936.1 Length = 663 Score = 79.3 bits (194), Expect = 1e-19 Identities = 62/174 (35%), Positives = 88/174 (50%), Gaps = 24/174 (13%) Query: 7 AHKFGDDVDTDAIIPGPYL---RTTDPYELASHCMAGIDENFPKKVKEG------DVIVA 57 A KFGD + TD I+P L R+ P + A + D F + E +VIV Sbjct: 477 AGKFGDKITTDDIMPAGDLLKYRSNVP-KYAQYVFVKRDPEFASRCLENKKKGLYNVIVG 535 Query: 58 GENFGCGSSREQAVIAIKYCGIKAVIAKSFARIFYRNAINVGLIPI----IANTDEIKDG 113 G+N+G GSSRE A + Y G+KAVIAK+ RI N IN G+IP+ + D+I G Sbjct: 536 GDNYGQGSSREHAALCPMYLGVKAVIAKAIERIHRANLINFGIIPLTFKNAEDYDKIDKG 595 Query: 114 DIVEIDLDKE-------EIVITNKNKTIKCETPKGL---EREILAAGGLVNYLK 157 D ++I ++ E+V+ N+ K I L ER+I+ AGG + K Sbjct: 596 DKIKISGIRKALIDGTGEVVLHNETKGIDIPLEYHLTERERKIILAGGKMRLAK 649 Lambda K H 0.318 0.139 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 324 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 170 Length of database: 663 Length adjustment: 28 Effective length of query: 142 Effective length of database: 635 Effective search space: 90170 Effective search space used: 90170 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory