Align Probable N-acetyl-LL-diaminopimelate aminotransferase; Putative aminotransferase A; EC 2.6.1.- (characterized)
to candidate WP_022950092.1 H035_RS0116640 pyridoxal phosphate-dependent aminotransferase
Query= SwissProt::P16524 (393 letters) >NCBI__GCF_000421465.1:WP_022950092.1 Length = 394 Score = 218 bits (555), Expect = 2e-61 Identities = 134/363 (36%), Positives = 203/363 (55%), Gaps = 15/363 (4%) Query: 25 AQHEDVISLTIGQPDFFTPHHVKAAAKKAIDENVTSYTPNAGYLELRQAVQLYMKKKADF 84 A+ DVI L G+PDF TP H+K AA +AI +T YTP G L+QAV ++ Sbjct: 29 AEGHDVIGLGAGEPDFDTPEHIKQAAIEAIRAGMTKYTPVDGIPSLKQAVADKFRRDNGL 88 Query: 85 NYDAESEIIITTGASQAIDAAFRTILSPGDEVIMPGPIYPGYEPIINLCGAKPVIVDT-T 143 Y + +I+++ G Q+ + +L GDEVI+P P + Y + L GA PV ++ Sbjct: 89 EYQTD-QILVSCGGKQSFYNLAQAMLDEGDEVIIPAPYWVSYPDMALLAGATPVFIEAGQ 147 Query: 144 SHGFKLTARLIEDALTPNTKCVVLPYPSNPTGVTLSEEELKSIA-ALLKGRNVFVLSDEI 202 + FK+T +E A+T TK V+ PSNPTG ++EE ++ LLK V + +D++ Sbjct: 148 AQAFKITPEQLEAAITARTKLFVINSPSNPTGKLYTKEEFAALGEVLLKHPRVAIATDDM 207 Query: 203 YSELTYDRPHY----SIATYLRDQTIVINGLSKSHSMTGWRIGFLFAPKDIAKHILKVHQ 258 Y + ++ + + L D+T V+NG+SK++SMTGWRIG+ PK++ + K+ Sbjct: 208 YEHIVWEEGSFCNILNACPDLSDRTFVLNGISKAYSMTGWRIGYAAGPKEVIGAMKKIQS 267 Query: 259 YNVSCASSISQKAALEAVTNGFDDALIMREQYKKRLDYVYDRLVSM-GLDVVKPSGAFYI 317 + S +SISQ AA+ A+ M E +K+R D+V L + G+D + GAFY+ Sbjct: 268 QSTSNPASISQAAAVAALEGDQSCIGRMVEAFKQRHDFVVGALNQIPGIDCLPAEGAFYL 327 Query: 318 FPS----IKSFGM-TSFDFSMALLEDAGVALVPGSSFSTYGEGYVRLSFACSMDTLREGL 372 FP I+ G+ S L+E AGVALVPG++F G+VRLS A SM+ L + Sbjct: 328 FPKVAGMIERLGLEDDLALSEYLIEKAGVALVPGTAFG--APGHVRLSIATSMENLENAV 385 Query: 373 DRL 375 DR+ Sbjct: 386 DRI 388 Lambda K H 0.319 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 326 Number of extensions: 16 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 394 Length adjustment: 31 Effective length of query: 362 Effective length of database: 363 Effective search space: 131406 Effective search space used: 131406 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory