Align [LysW]-L-2-aminoadipate 6-kinase monomer (EC 2.7.2.17) (characterized)
to candidate WP_022948270.1 H035_RS0106980 acetylglutamate kinase
Query= metacyc::MONOMER-6801 (269 letters) >NCBI__GCF_000421465.1:WP_022948270.1 Length = 301 Score = 129 bits (325), Expect = 6e-35 Identities = 83/274 (30%), Positives = 148/274 (54%), Gaps = 15/274 (5%) Query: 2 IVVKVGGAEGIN---YEAVAKDAASLWKEGVKLLLVHGGSAETNKVAEALGHPPRFLTHP 58 +V+K GG ++ + A+D L G+ ++VHGG + ++ E LG P RF+ Sbjct: 34 MVIKYGGNAMVDDTLKASFARDVVLLKLVGINPVVVHGGGPQIGRLLERLGKPSRFV--- 90 Query: 59 GGQVSRLTDRKTLEIFEMVYCGLVNKRLVELLQKEGANAIGLSGLDGRLFVGRRKTAVKY 118 + R+TD +T+++ EMV GLVNK +V LL + G +A+GL+G DG L R+ + Sbjct: 91 --EGMRVTDSETMDVVEMVLGGLVNKEIVSLLNQHGGHAVGLTGKDGALIRARKIFLQRT 148 Query: 119 VENGKV-KVHRGDYTGTVEEVNKALLDLLLQAGYLPVLTPPALSYENEAINTDGDQIAAL 177 + ++ + G V+ ++ A++D+L+ ++PV+ P + + + N + D +A Sbjct: 149 APEAQAPEIIDLGHVGEVDHIDPAVVDMLVHGDFIPVIAPIGVGEDGSSYNINADLVAGK 208 Query: 178 LATLYGAEALVYLSNVPGLLARYPDEASLVREIPVERIEDPEYLALAQGRMKRKVMGAVE 237 +A + GAE L+ L+N G+L + + L+ + + +E G M K+ A+E Sbjct: 209 VAQVLGAEKLILLTNTRGVLDK---DGQLLTGLSRQEVESLIADGTIAGGMIPKIRCAME 265 Query: 238 AVKGGVKRVVFADGRVENPIRRAL---SGEGTVV 268 A++ GV+ V DGRVE+ + L SG GT++ Sbjct: 266 ALQEGVRSVHIIDGRVEHAVLLELLTDSGIGTLL 299 Lambda K H 0.317 0.137 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 228 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 269 Length of database: 301 Length adjustment: 26 Effective length of query: 243 Effective length of database: 275 Effective search space: 66825 Effective search space used: 66825 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory