Align acetylglutamate kinase (EC 2.7.2.8) (characterized)
to candidate WP_028320081.1 H567_RS0101800 acetylglutamate kinase
Query= BRENDA::Q9HTN2 (301 letters) >NCBI__GCF_000422285.1:WP_028320081.1 Length = 293 Score = 336 bits (862), Expect = 3e-97 Identities = 169/284 (59%), Positives = 219/284 (77%) Query: 12 AKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPVVVHGGGPQ 71 AKVL EALPYI+RF G T+V+KYGG+AM E+LK FA D++L+K VG+NPVVVHGGGPQ Sbjct: 8 AKVLIEALPYIQRFNGATIVVKYGGHAMVDEKLKRDFALDIILLKYVGLNPVVVHGGGPQ 67 Query: 72 IGDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDA 131 IG+LLKRLSIE F+DGMRVTD TMDVVEMVL G+VNK+IV LIN +GG A+GL+GKD Sbjct: 68 IGELLKRLSIEPVFVDGMRVTDPQTMDVVEMVLVGKVNKEIVTLINTNGGRAVGLSGKDG 127 Query: 132 ELIRAKKLTVTRQTPEMTKPEIIDIGHVGEVTGVNVGLLNMLVKGDFIPVIAPIGVGSNG 191 +L+ A+++ + E PE+ID+G VGE+T V+ +L L++ FIPVIAP+G G+ G Sbjct: 128 QLVTAQRMKYLKSRGEDQPPELIDMGLVGEITAVDPTILLKLMEDAFIPVIAPVGGGAEG 187 Query: 192 ESYNINADLVAGKVAEALKAEKLMLLTNIAGLMDKQGQVLTGLSTEQVNELIADGTIYGG 251 E++NINADLVAG VA AL+A KL+LLT+ G++D+ G +L+ L + EL+ G I GG Sbjct: 188 ETFNINADLVAGAVASALRARKLILLTDTPGVLDQSGGLLSTLKEGEARELMGRGVIKGG 247 Query: 252 MLPKIRCALEAVQGGVTSAHIIDGRVPNAVLLEIFTDSGVGTLI 295 M+PK+ C L+A++GGV HIIDGR +A+LLEIFT GVGT I Sbjct: 248 MIPKVNCCLDALKGGVRKTHIIDGRQEHAILLEIFTKEGVGTEI 291 Lambda K H 0.318 0.138 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 332 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 293 Length adjustment: 26 Effective length of query: 275 Effective length of database: 267 Effective search space: 73425 Effective search space used: 73425 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate WP_028320081.1 H567_RS0101800 (acetylglutamate kinase)
to HMM TIGR00761 (argB: acetylglutamate kinase (EC 2.7.2.8))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00761.hmm # target sequence database: /tmp/gapView.3771814.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00761 [M=231] Accession: TIGR00761 Description: argB: acetylglutamate kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-84 269.0 1.0 2e-84 268.8 1.0 1.0 1 NCBI__GCF_000422285.1:WP_028320081.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000422285.1:WP_028320081.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 268.8 1.0 2e-84 2e-84 1 231 [] 25 268 .. 25 268 .. 0.97 Alignments for each domain: == domain 1 score: 268.8 bits; conditional E-value: 2e-84 TIGR00761 1 tiViKiGGaais..elleelakdiaklrkegiklvivHGGgpeinelleklgievefvnglRvTdketlevve 71 tiV+K+GG+a+ +l++++a di+ l+ +g+++v+vHGGgp+i ell++l ie+ fv+g+RvTd +t++vve NCBI__GCF_000422285.1:WP_028320081.1 25 TIVVKYGGHAMVdeKLKRDFALDIILLKYVGLNPVVVHGGGPQIGELLKRLSIEPVFVDGMRVTDPQTMDVVE 97 69*********98899********************************************************* PP TIGR00761 72 mvligkvnkelvallekhgikavGltgkDgqlltaekldke............dlgyvGeikkvnkelleall 132 mvl+gkvnke+v+l++ +g +avGl+gkDgql+ta+++++ d+g+vGei++v++ +l +l+ NCBI__GCF_000422285.1:WP_028320081.1 98 MVLVGKVNKEIVTLINTNGGRAVGLSGKDGQLVTAQRMKYLksrgedqppeliDMGLVGEITAVDPTILLKLM 170 ************************************6666556799*************************** PP TIGR00761 133 kagiipviaslaldeegqllNvnaDtaAaelAaaleAekLvlLtdvaGilegdkksliseleleeieqlikqa 205 + +ipvia+++ +eg+++N+naD +A+++A+al A kL+lLtd++G+l++++ l+s l+ e+++l+ + NCBI__GCF_000422285.1:WP_028320081.1 171 EDAFIPVIAPVGGGAEGETFNINADLVAGAVASALRARKLILLTDTPGVLDQSGG-LLSTLKEGEARELMGRG 242 ****************************************************776.***************** PP TIGR00761 206 vikgGmipKveaalealesgvkkvvi 231 vikgGmipKv+++l+al++gv+k +i NCBI__GCF_000422285.1:WP_028320081.1 243 VIKGGMIPKVNCCLDALKGGVRKTHI 268 ***********************998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (231 nodes) Target sequences: 1 (293 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 18.16 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory