Align phosphoserine aminotransferase monomer (EC 2.6.1.1; EC 2.6.1.52) (characterized)
to candidate WP_028990417.1 G579_RS0112280 alanine--glyoxylate aminotransferase family protein
Query= metacyc::MONOMER-15919 (385 letters) >NCBI__GCF_000423825.1:WP_028990417.1 Length = 394 Score = 235 bits (600), Expect = 1e-66 Identities = 138/364 (37%), Positives = 205/364 (56%), Gaps = 5/364 (1%) Query: 8 KLLMIPGPTMVPPEVLNAMALPVIGHRTKDYSNLLEDTIEKLKKVFITEND-TFLITGSG 66 + LM PGP+ V P VL AM+ P IGH + +++E+ L+ F T N T ++G G Sbjct: 11 RTLMGPGPSDVNPRVLEAMSRPTIGHLDPVFVDMMEELKSLLQYAFQTGNQLTMPVSGPG 70 Query: 67 TAAMDMAISNIIKRGDKVLNIVTGNFGERFANIVKAYKGEAIRLDVEWGDMAEPEAVKEI 126 +A M+ N+++ GDKV+ G FG R V+ G A+ ++ WG +P+ +K+ Sbjct: 71 SAGMETCFVNLVEPGDKVIVCQNGVFGGRMKENVERCGGTAVMVEDAWGSAVDPQKLKDA 130 Query: 127 LDKYDDIKAVTVVHNETSTGARNPIKEIGEVVKDYDALYIVDTVSSLGGDYVNVDKFHID 186 L + D K V VH ETSTGA++ K + E+ +D L IVDTV+SLGG V VD++ ID Sbjct: 131 LQAHPDAKLVAFVHAETSTGAQSDAKALVEIAHRHDCLVIVDTVTSLGGTPVKVDEWGID 190 Query: 187 ICVTGSQKCLAAPPGLAAITVSEKAWEVIKKNDDKV-GFYLDLLAYKKYYEE--KKQTPY 243 +G+QKCL+ PGL+ ++ SE+A E IK KV +++DL Y+ K+ + Sbjct: 191 AVYSGTQKCLSCTPGLSPVSFSERAMERIKHRKTKVQSWFMDLNLVMGYWGSGAKRAYHH 250 Query: 244 TPSVNLTYALNVALDLVLEEGIENRVKRHERLAKATRAGLEAMGIELFAKERARSVTVTS 303 T +N Y L+ AL ++ EEG+EN RH +A AG+EAMG++ KE R + + Sbjct: 251 TAPINALYGLHEALVILQEEGLENAWARHAHAHRALLAGIEAMGLKFVVKEDERLPQLNA 310 Query: 304 AKYPEGIEDSKFRGILSNKYNIVVAGGQKHLAGKIFRIGHMGI-CGEKEVLATLACVELA 362 PEG++D+ R L YN+ + G +AGKI+RIG MG K VL L +E Sbjct: 311 VGIPEGVDDAAVRAQLLQDYNLEIGAGLGPMAGKIWRIGLMGYGANPKNVLFCLGALEDV 370 Query: 363 LKEL 366 L + Sbjct: 371 LSRM 374 Lambda K H 0.316 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 358 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 394 Length adjustment: 30 Effective length of query: 355 Effective length of database: 364 Effective search space: 129220 Effective search space used: 129220 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory