Align 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7) (characterized)
to candidate WP_028989320.1 G579_RS0105155 4-hydroxy-tetrahydrodipicolinate synthase
Query= BRENDA::Q9I4W3 (292 letters) >NCBI__GCF_000423825.1:WP_028989320.1 Length = 291 Score = 359 bits (922), Expect = e-104 Identities = 185/291 (63%), Positives = 223/291 (76%) Query: 1 MIAGSMVALVTPFDAQGRLDWDSLAKLVDFHLQEGTNAIVAVGTTGESATLDVEEHIQVI 60 M GSMVALVTP G LD L +LV++HL EGT+AIVAVGTTGESATL+ EH++ I Sbjct: 1 MFQGSMVALVTPMQDDGTLDEVRLRELVEWHLSEGTDAIVAVGTTGESATLNETEHLRAI 60 Query: 61 RRVVDQVKGRIPVIAGTGANSTREAVALTEAAKSGGADACLLVTPYYNKPTQEGMYQHFR 120 + VV+QV+ R PVIAGTGAN+T EA+ALT AA GADA LLVTPYYNKPTQEG++QH+R Sbjct: 61 QIVVEQVRERAPVIAGTGANATSEAIALTTAAAELGADAALLVTPYYNKPTQEGLFQHYR 120 Query: 121 HIAEAVAIPQILYNVPGRTSCDMLPETVERLSKVPNIIGIKEATGDLQRAKEVIERVGKD 180 IA+A +PQILYNVPGRT CD+ P T+ERL+ +PNIIG+KEATG++ RA+E++ R G Sbjct: 121 AIAQACPLPQILYNVPGRTGCDLQPATIERLAAIPNIIGVKEATGNITRAEEILARCGGR 180 Query: 181 FLVYSGDDATAVELMLLGGKGNISVTANVAPRAMSDLCAAAMRGDAAAARAINDRLMPLH 240 VY+GDDA+A+ LMLLG KG ISVTANVAP M+ +C AA GD A AR +ND+L+PLH Sbjct: 181 MDVYAGDDASALALMLLGAKGVISVTANVAPGDMARMCRAAREGDLATARTLNDKLLPLH 240 Query: 241 KALFIESNPIPVKWALHEMGLIPEGIRLPLTWLSPRCHEPLRQAMRQTGVL 291 LF+ESNPIPVKWAL EMG I +RLPLT LS L +MRQ G L Sbjct: 241 VDLFLESNPIPVKWALAEMGRIGPMLRLPLTPLSESLRPQLLASMRQAGCL 291 Lambda K H 0.319 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 302 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 291 Length adjustment: 26 Effective length of query: 266 Effective length of database: 265 Effective search space: 70490 Effective search space used: 70490 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate WP_028989320.1 G579_RS0105155 (4-hydroxy-tetrahydrodipicolinate synthase)
to HMM TIGR00674 (dapA: 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00674.hmm # target sequence database: /tmp/gapView.1913130.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00674 [M=286] Accession: TIGR00674 Description: dapA: 4-hydroxy-tetrahydrodipicolinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.8e-112 359.8 0.0 4.2e-112 359.6 0.0 1.0 1 NCBI__GCF_000423825.1:WP_028989320.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000423825.1:WP_028989320.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 359.6 0.0 4.2e-112 4.2e-112 2 282 .. 5 284 .. 4 288 .. 0.98 Alignments for each domain: == domain 1 score: 359.6 bits; conditional E-value: 4.2e-112 TIGR00674 2 vltAliTPfkedgsvdfaalekliesqiekgvdaivvvGtTGEsatLsleEkkkvievavelvknrvpviaGt 74 +++Al+TP+++dg++d l +l+e ++++g+daiv+vGtTGEsatL+ E+ + i+++ve v++r pviaGt NCBI__GCF_000423825.1:WP_028989320.1 5 SMVALVTPMQDDGTLDEVRLRELVEWHLSEGTDAIVAVGTTGESATLNETEHLRAIQIVVEQVRERAPVIAGT 77 799********************************************************************** PP TIGR00674 75 gsnateeaieltkeaeklgvdgvlvvtPyYnkPtqeGlykhfkaiaeevelPiilYnvPsRtgvslepetvkr 147 g+nat+eai lt+ a++lg+d++l+vtPyYnkPtqeGl++h+ aia+++ lP+ilYnvP+Rtg++l+p t+ r NCBI__GCF_000423825.1:WP_028989320.1 78 GANATSEAIALTTAAAELGADAALLVTPYYNKPTQEGLFQHYRAIAQACPLPQILYNVPGRTGCDLQPATIER 150 ************************************************************************* PP TIGR00674 148 LaeeveivaiKeasgdlervseikaeakedfkvlsGdDaltleilalGakGviSVasnvapkelkemvkaale 220 La+ ++i+++Kea+g+++r+ ei a+ + + v++GdDa +l++++lGakGviSV++nvap +++ m++aa e NCBI__GCF_000423825.1:WP_028989320.1 151 LAAIPNIIGVKEATGNITRAEEILARCGGRMDVYAGDDASALALMLLGAKGVISVTANVAPGDMARMCRAARE 223 ************************************************************************* PP TIGR00674 221 gdteeareihqkllklfkalfietNPipvKtalallgliekdelRlPLtelseekkeklkev 282 gd + ar ++ kll+l+ lf+e+NPipvK+ala +g i lRlPLt+lse+ + +l + NCBI__GCF_000423825.1:WP_028989320.1 224 GDLATARTLNDKLLPLHVDLFLESNPIPVKWALAEMGRIGP-MLRLPLTPLSESLRPQLLAS 284 ***************************************88.************99988655 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (286 nodes) Target sequences: 1 (291 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 12.14 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory