Align Aromatic-amino-acid transaminase (EC 2.6.1.57) (characterized)
to candidate WP_028990084.1 G579_RS0110095 histidinol-phosphate transaminase
Query= reanno::BFirm:BPHYT_RS14905 (370 letters) >NCBI__GCF_000423825.1:WP_028990084.1 Length = 371 Score = 363 bits (933), Expect = e-105 Identities = 191/358 (53%), Positives = 242/358 (67%), Gaps = 5/358 (1%) Query: 10 VRAIAPYIAGKPISEVAREFGLDEATIVKLASNENPLGMPESAQRAMAQAASELGRYPDA 69 V + PY GKPI + RE+G+ A +KLASNENPLG A A+ +A+++L YPD Sbjct: 17 VAGLKPYEPGKPIETLEREYGVRNA--IKLASNENPLGPSPLALEAVIKASAKLALYPDG 74 Query: 70 NAFELKAALSERYGVPADWVTLGNGSNDILEIAAHAFVEKGQSIVYAQYSFAVYALATQG 129 F LKAAL GV + V LGNGSN+ILE+ FV +V+++++FAVY + TQ Sbjct: 75 AGFALKAALGRHLGVQPEQVVLGNGSNEILELVTRTFVTPADEVVFSEHAFAVYPIVTQA 134 Query: 130 LGARAIVVPAVKYGHDLDAMLAAVSDDTRLIFVANPNNPTGTFIEGPKLEAFLDKVPRHV 189 +GA A V PA YGHDLDAM V+++TRL+FVANPNNPTGT++ LEAF+ +P HV Sbjct: 135 VGATARVAPARDYGHDLDAMAGLVNENTRLVFVANPNNPTGTYLAREALEAFITSMPSHV 194 Query: 190 VVVLDEAYTEYLPQEKRYDSIAWVRRYPNLLVSRTFSKAFGLAGLRVGFAIAQPELTDLL 249 +VVLDEAY E++ D IAW+ R+ NLLV+RTFSK +GLAGLRVG+ + P+L LL Sbjct: 195 LVVLDEAYFEFVDAPDYPDGIAWLERFDNLLVTRTFSKIYGLAGLRVGYGVGHPKLISLL 254 Query: 250 NRVRQPFNVNTLAQAAAIAALNDKAFLEKSAALNAQGYRRLTEAFDKLGLEYVPSDGNFV 309 RVRQPFNVN+ A AAA AAL D L +S ALNA G +L + LGL +PS GNF+ Sbjct: 255 ERVRQPFNVNSAAMAAAEAALADHEHLRRSRALNASGMAQLVAGIEALGLHALPSVGNFL 314 Query: 310 LVRVGNDDAAGNRVNLELLKQGVIVRPVGNYGLPQWLRITIGLPEENEAFIAALERTL 367 V VG D A V LL+QGVIVRPV YG+P++LR+TIG PEEN F+ ALE L Sbjct: 315 AVHVGRDAAP---VYEALLRQGVIVRPVAGYGMPEFLRVTIGRPEENARFLQALEAAL 369 Lambda K H 0.318 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 436 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 370 Length of database: 371 Length adjustment: 30 Effective length of query: 340 Effective length of database: 341 Effective search space: 115940 Effective search space used: 115940 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory