Align imidazole glycerol-phosphate synthase (EC 4.3.2.10) (characterized)
to candidate WP_027722353.1 H589_RS0112630 imidazole glycerol phosphate synthase subunit HisF
Query= BRENDA::Q9SZ30 (592 letters) >NCBI__GCF_000425265.1:WP_027722353.1 Length = 259 Score = 155 bits (393), Expect = 1e-42 Identities = 105/312 (33%), Positives = 165/312 (52%), Gaps = 57/312 (18%) Query: 280 LAKRVIACLDVRTNDKGDLVVTKGDQYDVREQSNENEVRNLGKPVDLAGQYYKDGADEIS 339 L+KR+I CLDVR V+TKG ++ + ++G PV+ A YY+ GADEI Sbjct: 2 LSKRIIPCLDVRNG-----VLTKGVKF--------KDNIDIGDPVETAKLYYEQGADEIV 48 Query: 340 FLNITGFRDFPLGDLPMIQVLRQTSKNVFVPLTVGGGIRDFTDASGRYYSSLEVAAEYFR 399 F +IT + G + V+ + + +F+P +VGGGI +++E Sbjct: 49 FYDITASSE---GRGIFLDVVERVASEIFIPFSVGGGI-----------NTVEDMRAVLL 94 Query: 400 SGADKISIGSDAVSAAEEFIKSGVKTGKSSLEQISRVYGNQAVVVSIDPRRVYVNHPDDV 459 +GA+K+S+ S AV + I G + +G+Q +V+ +D +RV + Sbjct: 95 AGAEKVSVNSGAVKNPD-IISEG-----------AAAFGSQCIVLGMDVKRVEKS----- 137 Query: 460 PYKVIRVTNPGPNGEEYAWYQCTVSGGREGRPIGAFELAKAVEELGAGEILLNCIDCDGQ 519 ++I P+G ++ ++GGR+ I A E AK E LGAGEI LN ID DG Sbjct: 138 --ELI------PSG-----FEIVINGGRKFMGIDALEWAKTCEALGAGEICLNSIDADGT 184 Query: 520 GKGFDIDLVKLISDSVGIPVIASSGAGTPDHFSEVFEKTNASAALAAGIFHRKEVPIQSV 579 G+D++L +LI+++VG+PVIAS GAG P H + + A+AAL A I H E I + Sbjct: 185 KDGYDLELTRLIAENVGVPVIASGGAGHPQHMVDAVTEGRATAALIASIVHYGEYTIPQI 244 Query: 580 KEHLQEERIEVR 591 KE+++ + + R Sbjct: 245 KEYMESKGVRTR 256 Lambda K H 0.317 0.135 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 385 Number of extensions: 20 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 592 Length of database: 259 Length adjustment: 30 Effective length of query: 562 Effective length of database: 229 Effective search space: 128698 Effective search space used: 128698 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory