Align O-phosphoserine sulfhydrylase monomer (EC 2.5.1.47; EC 2.5.1.65) (characterized)
to candidate WP_037374637.1 A3GO_RS0104205 cysteine synthase A
Query= metacyc::MONOMER-20568 (299 letters) >NCBI__GCF_000428045.1:WP_037374637.1 Length = 303 Score = 229 bits (585), Expect = 5e-65 Identities = 134/309 (43%), Positives = 182/309 (58%), Gaps = 20/309 (6%) Query: 1 MIYDNILETIGNTPLVRINHLNPNPKVQMYAKLEGFNPTGSVKDRIALKMIEQAEAEGKL 60 M YDNIL+TIGNTP++R+N +++ KLE FNP GSVKDR AL MIE AE G+L Sbjct: 1 MKYDNILQTIGNTPVIRLNRFPDTLAAELWVKLESFNPAGSVKDRPALNMIECAEQRGEL 60 Query: 61 HPGSTIIEATSGNTGIGLAMIGRVKGYNVIIVMSEGVSIERRKMIKAFGAEIILTDKKLG 120 PG TIIE TSGNTGIGLAMI KGY + VM+E +S ER+ +++AFG +++LT + G Sbjct: 61 KPGDTIIEPTSGNTGIGLAMIAAQKGYPSVFVMAEDMSEERKTILRAFGGKLVLTPAEKG 120 Query: 121 TDGAIRKVAELVKEN----PGKYFNPNQFSNEYNKIAHYKTTAEEIWAQTKGTVTHFVAA 176 T GAI + +L +N G++FNP+ N AH K TA+EIWA + V Sbjct: 121 TKGAIEEAKKLAAKNGWFFVGQHFNPD------NPNAH-KGTADEIWADFGTRLDAIVCT 173 Query: 177 VGTSGTLMGVGKNLREKNPEIKIIEAQPTKGHYI-QGLKSMEE------AIVPAIYQADK 229 GT GT+ G+GK +R NPEI+II +P + QG+ + +P I Sbjct: 174 TGTGGTISGIGKYMRRHNPEIQIIATEPADSPILSQGIACKHKIMGTAPGFIPDILDTKI 233 Query: 230 IDEHILIESEEAFAKAREIVAQEGIFIGMSSGAAMLAAQKLA--EKIDSGVIVVLFADRG 287 + I ++EA+ R + EGIF G+SSGAA+ K A E +I+ + D G Sbjct: 234 YNRIFQITTDEAYDTTRRLAQHEGIFAGISSGAAVAGMIKAAREEAFRGKIILAMLPDTG 293 Query: 288 EKYLSTKLF 296 E+YLST L+ Sbjct: 294 ERYLSTDLW 302 Lambda K H 0.315 0.133 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 318 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 299 Length of database: 303 Length adjustment: 27 Effective length of query: 272 Effective length of database: 276 Effective search space: 75072 Effective search space used: 75072 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory