Align cysteine synthase (EC 2.5.1.47); L-3-cyanoalanine synthase (EC 4.4.1.9) (characterized)
to candidate WP_037374637.1 A3GO_RS0104205 cysteine synthase A
Query= BRENDA::Q84IF9 (308 letters) >NCBI__GCF_000428045.1:WP_037374637.1 Length = 303 Score = 305 bits (782), Expect = 7e-88 Identities = 158/300 (52%), Positives = 208/300 (69%), Gaps = 2/300 (0%) Query: 6 NSITELIGDTPAVKLNRIVDEDSADVYLKLEFMNPGSSVKDRIALAMIEAAEKAGKLKPG 65 ++I + IG+TP ++LNR D +A++++KLE NP SVKDR AL MIE AE+ G+LKPG Sbjct: 4 DNILQTIGNTPVIRLNRFPDTLAAELWVKLESFNPAGSVKDRPALNMIECAEQRGELKPG 63 Query: 66 DTIVEPTSGNTGIGLAMVAAAKGYKAVLVMPDTMSLERRNLLRAYGAELVLTPGAQGMRG 125 DTI+EPTSGNTGIGLAM+AA KGY +V VM + MS ER+ +LRA+G +LVLTP +G +G Sbjct: 64 DTIIEPTSGNTGIGLAMIAAQKGYPSVFVMAEDMSEERKTILRAFGGKLVLTPAEKGTKG 123 Query: 126 PIAKAEELVREHGYFMPQQFKNEANPEIHRLTTGKEIVEQMGDQLDAFVAGVGTGGTTTG 185 I +A++L ++G+F Q N NP H+ T EI G +LDA V GTGGT +G Sbjct: 124 AIEEAKKLAAKNGWFFVGQHFNPDNPNAHK-GTADEIWADFGTRLDAIVCTTGTGGTISG 182 Query: 186 AGKVLREAYPNIKIYAVEPADSPVLSGGKPGPHKIQGIGAGFVPDILDTSIYDGVITVTT 245 GK +R P I+I A EPADSP+LS G HKI G GF+PDILDT IY+ + +TT Sbjct: 183 IGKYMRRHNPEIQIIATEPADSPILSQGIACKHKIMGTAPGFIPDILDTKIYNRIFQITT 242 Query: 246 EEAFAAARRAAREEGILGGISSGAAIHAALKVAKELG-KGKKVLAIIPSNGERYLSTPLY 304 +EA+ RR A+ EGI GISSGAA+ +K A+E +GK +LA++P GERYLST L+ Sbjct: 243 DEAYDTTRRLAQHEGIFAGISSGAAVAGMIKAAREEAFRGKIILAMLPDTGERYLSTDLW 302 Lambda K H 0.314 0.134 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 276 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 303 Length adjustment: 27 Effective length of query: 281 Effective length of database: 276 Effective search space: 77556 Effective search space used: 77556 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 48 (23.1 bits)
Align candidate WP_037374637.1 A3GO_RS0104205 (cysteine synthase A)
to HMM TIGR01136 (cysteine synthase (EC 2.5.1.47))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01136.hmm # target sequence database: /tmp/gapView.2924656.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01136 [M=299] Accession: TIGR01136 Description: cysKM: cysteine synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.1e-124 398.8 0.0 9.1e-124 398.6 0.0 1.0 1 NCBI__GCF_000428045.1:WP_037374637.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000428045.1:WP_037374637.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 398.6 0.0 9.1e-124 9.1e-124 2 299 .] 7 302 .. 6 302 .. 0.99 Alignments for each domain: == domain 1 score: 398.6 bits; conditional E-value: 9.1e-124 TIGR01136 2 eeliGntPlvrln.lseelkaevlvKlEsrnPsgSvKdRialsmildAekrgllkkgktiieatSGNtGiaLA 73 ++iGntP++rln + + l+ae++vKlEs+nP+gSvKdR+al+mi+ Ae+rg+lk+g+tiie+tSGNtGi+LA NCBI__GCF_000428045.1:WP_037374637.1 7 LQTIGNTPVIRLNrFPDTLAAELWVKLESFNPAGSVKDRPALNMIECAEQRGELKPGDTIIEPTSGNTGIGLA 79 789**********999999****************************************************** PP TIGR01136 74 mvaaakgyklilvmpetmslERrkllkayGaelvlteaeegmkgaiekakelaeeepekyvllkqfeNpaNpe 146 m+aa+kgy + vm e+ms+ER+++l+a+G +lvlt+ae+g+kgaie+ak+la++++ ++++ q+ Np+Np+ NCBI__GCF_000428045.1:WP_037374637.1 80 MIAAQKGYPSVFVMAEDMSEERKTILRAFGGKLVLTPAEKGTKGAIEEAKKLAAKNG--WFFVGQHFNPDNPN 150 *******************************************************76..99************ PP TIGR01136 147 aHrkttgpEilkdtdgkidafvagvGtgGtitGvgrvlkekkpnvkivavePaespvlsegkpgphkiqgiga 219 aH+ t+ Ei++d+ ++da+v ++GtgGti+G+g+++++++p+++i+a ePa+sp+ls+g + +hki g+ + NCBI__GCF_000428045.1:WP_037374637.1 151 AHK-GTADEIWADFGTRLDAIVCTTGTGGTISGIGKYMRRHNPEIQIIATEPADSPILSQGIACKHKIMGTAP 222 **6.79******************************************************************* PP TIGR01136 220 gfiPkildeelldevikvededaietarrlakeegilvGiSsGaavaaalkvakklekedkkivvilpdager 292 gfiP+ild++++++++++++++a++t+rrla++egi++GiSsGaava ++k a+++++++k i+++lpd+ger NCBI__GCF_000428045.1:WP_037374637.1 223 GFIPDILDTKIYNRIFQITTDEAYDTTRRLAQHEGIFAGISSGAAVAGMIKAAREEAFRGKIILAMLPDTGER 295 ************************************************************************* PP TIGR01136 293 YLstelf 299 YLst+l+ NCBI__GCF_000428045.1:WP_037374637.1 296 YLSTDLW 302 *****97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (299 nodes) Target sequences: 1 (303 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 12.57 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory