Align Probable adenylyltransferase/sulfurtransferase MoeZ; EC 2.7.7.-; EC 2.8.1.- (characterized)
to candidate WP_029134773.1 A3GO_RS0119155 molybdopterin-synthase adenylyltransferase MoeB
Query= SwissProt::P9WMN7 (392 letters) >NCBI__GCF_000428045.1:WP_029134773.1 Length = 248 Score = 199 bits (506), Expect = 7e-56 Identities = 103/245 (42%), Positives = 155/245 (63%), Gaps = 5/245 (2%) Query: 15 LSREEVARYSRHLIIPDLGVDGQKRLKNARVLVIGAGGLGAPTLLYLAAAGVGTIGIVDF 74 ++ +++ RYSR +++P +G++GQ +L +RV++ G GGLG+P +YLAAAG+G + +VDF Sbjct: 1 MNDDQLLRYSRQIMLPSIGIEGQDKLLQSRVVIFGLGGLGSPAAMYLAAAGIGELVLVDF 60 Query: 75 DVVDESNLQRQVIHGVADVGRSKAQSARDSIVAINPLIRVRLHELRLAPSNAVDLFKQYD 134 D VD +NLQRQ+IH +G+ K SAR ++ ++NP R+ RL ++ D Sbjct: 61 DRVDLTNLQRQIIHTTGSIGQLKVDSARQTLRSLNPECRIETVSSRLEGEELEREIRRAD 120 Query: 135 LILDGTDNFATRYLVNDAAVLAGKPYVWGSIYRFEGQASVFWEDAPDGLGVNYRDLYPEP 194 L++DGTDNF TR+ +N+A V P V G+ R EGQ SVF A + YR LY Sbjct: 121 LVVDGTDNFTTRFAINEACVKHQIPLVSGAAIRMEGQVSVFTGRADEPC---YRCLYGSA 177 Query: 195 PPPGMVPSCAEGGVLGIICASVASVMGTEAIKLITGIGETLLGRLLVYDALEMSYRTITI 254 + +C+ GVL + + SV EAIK++TG G L+GRLLV DALEM +R++ + Sbjct: 178 AE--LDETCSANGVLSPLVGIIGSVQALEAIKVLTGSGSPLIGRLLVLDALEMQWRSLIL 235 Query: 255 RKDPS 259 +KDP+ Sbjct: 236 KKDPA 240 Lambda K H 0.319 0.137 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 237 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 392 Length of database: 248 Length adjustment: 27 Effective length of query: 365 Effective length of database: 221 Effective search space: 80665 Effective search space used: 80665 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory