Align cystathionine gamma-lyase (EC 4.4.1.1) (characterized)
to candidate WP_029132673.1 A3GO_RS0106215 O-succinylhomoserine sulfhydrylase
Query= BRENDA::Q5H4T8 (397 letters) >NCBI__GCF_000428045.1:WP_029132673.1 Length = 394 Score = 316 bits (809), Expect = 8e-91 Identities = 177/388 (45%), Positives = 248/388 (63%), Gaps = 12/388 (3%) Query: 17 LATLAIHGGQSPDPSTGAVMPPIYATSTYAQSSP--------GEHQGFEYSRTHNPTRFA 68 LAT AI G + G PI+ TS++ S G+ G YSR NPT Sbjct: 10 LATRAIRAGHIRT-AEGEHSEPIFTTSSFVFQSAAEAAARFSGDEPGNIYSRFTNPTVAC 68 Query: 69 YERCVAALEGGTRAFAFASGMAAT-STVMELLDAGSHVVAMDDLYGGTFRLFERVRRRTA 127 +E+ +AALEGG A ASGM+A +T M LL AG H+V+ ++G T LF + + Sbjct: 69 FEQRLAALEGGEACVATASGMSAILATCMALLKAGDHIVSSRSIFGTTNVLFNKFLAKV- 127 Query: 128 GLDFSFVDLTDPAAFKAAIRADTKMVWIETPTNPMLKLVDIAAIAVIARKHGLLTVVDNT 187 G+ SFV L+D +A++AAIR DT++++ ETP+NP+ +L DIAA+A +A GLL VVDN Sbjct: 128 GISTSFVPLSDLSAWEAAIRPDTRILYAETPSNPITELGDIAALADLAHARGLLLVVDNC 187 Query: 188 FASPMLQRPLSLGADLVVHSATKYLNGHSDMVGGIAVVGDNAELAEQMAFLQNSIGGVQG 247 F +P LQ+PL+LGAD+V+HSATKYL+G VGG AVVGD + E++ + G Sbjct: 188 FCTPALQQPLALGADIVIHSATKYLDGQGRCVGG-AVVGDAKLVGEEVFGFLRTAGPTMS 246 Query: 248 PFDSFLALRGLKTLPLRMRAHCENALALAQWLETHPAIEKVIYPGLASHPQHVLAKRQMS 307 PF++++ L+GL+TL LRMRAH ENAL LA+WLE A+E+V YPGL SHPQ+ LA+RQ Sbjct: 247 PFNAWVFLKGLETLQLRMRAHSENALQLARWLERQDAVEQVYYPGLQSHPQYALAQRQQK 306 Query: 308 GFGGIVSIVLKGGFDAAKRFCEKTELFTLAESLGGVESLVNHPAVMTHASIPVARREQLG 367 GG++S V+KGG + A R + T + ++ +LG +S + HPA TH + +E G Sbjct: 307 AAGGMLSFVVKGGREQAWRLIDATRMISITANLGDTKSTITHPASTTHGRLTDEEKELSG 366 Query: 368 ISDALVRLSVGIEDLGDLRGDLERALVN 395 I D L+R++VG+ED+ D++ DLE L N Sbjct: 367 IEDGLIRIAVGLEDIEDIQHDLEAGLAN 394 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 442 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 394 Length adjustment: 31 Effective length of query: 366 Effective length of database: 363 Effective search space: 132858 Effective search space used: 132858 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory