Align branched-chain-amino-acid transaminase (EC 2.6.1.42) (characterized)
to candidate WP_029134555.1 A3GO_RS0117805 branched-chain amino acid transaminase
Query= BRENDA::O86428 (307 letters) >NCBI__GCF_000428045.1:WP_029134555.1 Length = 307 Score = 427 bits (1097), Expect = e-124 Identities = 205/305 (67%), Positives = 240/305 (78%) Query: 2 SMADRDGVIWYDGELVQWRDATTHVLTHTLHYGMGVFEGVRAYDTPQGTAIFRLQAHTDR 61 + ADRDG IW DGE+V WR+A HVLTHTLHYG+GVFEGVRAY T QG AIF+L+ HT R Sbjct: 3 NFADRDGWIWLDGEMVPWREAKVHVLTHTLHYGLGVFEGVRAYKTEQGPAIFKLEEHTRR 62 Query: 62 LFDSAHIMNMQIPYSRDEINEATRAAVRENNLESAYIRPMVFYGSEGMGLRASGLKVHVI 121 LF SAHIM M++PY +N+A VREN L+SAY+RP+ FYGSEGMG+RA L VHV+ Sbjct: 63 LFQSAHIMGMKMPYDEATLNQAQVDVVRENGLDSAYLRPLCFYGSEGMGIRADSLGVHVM 122 Query: 122 IAAWSWGAYMGEEALQQGIKVRTSSFTRHHVNISMTRAKSNGAYINSMLALQEAISGGAD 181 IAAW WGAY+GE+ L+ GI++R SS+TRH VN M +AK+ G YINSMLALQEA++ G D Sbjct: 123 IAAWEWGAYLGEDNLKNGIRIRVSSYTRHQVNSMMCKAKATGNYINSMLALQEAVNDGYD 182 Query: 182 EAMMLDPEGYVAEGSGENIFIIKDGVIYTPEVTACLNGITRNTILTLAAEHGFKLVEKRI 241 EA++LD GYV EGSGEN F++KDGVIYTP++T+ LNGITR TI T E G +VEKRI Sbjct: 183 EALILDASGYVMEGSGENFFLVKDGVIYTPDLTSVLNGITRKTIFTFTQELGIPIVEKRI 242 Query: 242 TRDEVYIADEAFFTGTAAEVTPIREVDGRKIGAGRRGPVTEKLQKAYFDLVSGKTEAHAE 301 TRDEVYIADEAFFTGTAAEVTPIREVD R IG G RGP+TEKLQ YFD V G+ H E Sbjct: 243 TRDEVYIADEAFFTGTAAEVTPIREVDNRTIGNGGRGPITEKLQTLYFDHVHGRRAEHPE 302 Query: 302 WRTLV 306 W T V Sbjct: 303 WLTYV 307 Lambda K H 0.319 0.134 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 414 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 307 Length adjustment: 27 Effective length of query: 280 Effective length of database: 280 Effective search space: 78400 Effective search space used: 78400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate WP_029134555.1 A3GO_RS0117805 (branched-chain amino acid transaminase)
to HMM TIGR01122 (ilvE: branched-chain amino acid aminotransferase (EC 2.6.1.42))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01122.hmm # target sequence database: /tmp/gapView.1640642.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01122 [M=298] Accession: TIGR01122 Description: ilvE_I: branched-chain amino acid aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-138 445.8 0.1 3.7e-138 445.7 0.1 1.0 1 NCBI__GCF_000428045.1:WP_029134555.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000428045.1:WP_029134555.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 445.7 0.1 3.7e-138 3.7e-138 1 298 [] 12 307 .] 12 307 .] 0.99 Alignments for each domain: == domain 1 score: 445.7 bits; conditional E-value: 3.7e-138 TIGR01122 1 wldGelvdvedakvhvlthalhYGtgvfeGiRaYetdkglaifrlkehveRlydsakilrleipyskeelvev 73 wldGe+v++++akvhvlth+lhYG gvfeG+RaY+t++g+aif+l+eh+ Rl++sa+i+ +++py + +l+++ NCBI__GCF_000428045.1:WP_029134555.1 12 WLDGEMVPWREAKVHVLTHTLHYGLGVFEGVRAYKTEQGPAIFKLEEHTRRLFQSAHIMGMKMPYDEATLNQA 84 9************************************************************************ PP TIGR01122 74 tkevlrknnlksaYiRplvyvGaedlglkpkvdlkveviiaawewgaylgeealekGikvkvssfrraavnsi 146 +++v+r+n+l+saY+Rpl ++G+e++g+++ +l v+v+iaawewgaylge+ l++Gi+++vss++r++vns+ NCBI__GCF_000428045.1:WP_029134555.1 85 QVDVVRENGLDSAYLRPLCFYGSEGMGIRA-DSLGVHVMIAAWEWGAYLGEDNLKNGIRIRVSSYTRHQVNSM 156 ******************************.7789************************************** PP TIGR01122 147 ptkakaagnYlnsllaksealraGydeailLdeeGyvaeGsGenifivkdgvlltPpvsesiLkgitrdavik 219 + kaka+gnY+ns+la +ea++ Gydea++Ld +Gyv eGsGen+f+vkdgv++tP++ +s+L+gitr ++ + NCBI__GCF_000428045.1:WP_029134555.1 157 MCKAKATGNYINSMLALQEAVNDGYDEALILDASGYVMEGSGENFFLVKDGVIYTPDL-TSVLNGITRKTIFT 228 **********************************************************.78************ PP TIGR01122 220 lakelgievkeerisreelytaDevfltGtaaevtPirevDgrkigegkrGpvtkklqeaffdlvegktekke 292 + +elgi ++e+ri+r+e+y+aDe+f+tGtaaevtPirevD+r+ig+g rGp+t+klq+ +fd v+g+ ++ NCBI__GCF_000428045.1:WP_029134555.1 229 FTQELGIPIVEKRITRDEVYIADEAFFTGTAAEVTPIREVDNRTIGNGGRGPITEKLQTLYFDHVHGRRAEHP 301 ************************************************************************* PP TIGR01122 293 ewltyv 298 ewltyv NCBI__GCF_000428045.1:WP_029134555.1 302 EWLTYV 307 ****98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (307 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 21.53 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory