Align 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54) (characterized)
to candidate WP_028313202.1 G491_RS0100580 3-deoxy-7-phosphoheptulonate synthase
Query= BRENDA::Q9WYH8 (338 letters) >NCBI__GCF_000429905.1:WP_028313202.1 Length = 339 Score = 319 bits (817), Expect = 7e-92 Identities = 161/331 (48%), Positives = 224/331 (67%) Query: 1 MIVVLKPGSTEEDIRKVVKLAESYNLKCHISKGQERTVIGIIGDDRYVVADKFESLDCVE 60 M++V+K +T++ I V+K E+ G RT IGI+ + V +F+ L V+ Sbjct: 1 MLLVMKQNATQDQIDDVIKRIEAAGFTARPIPGGHRTAIGILHNQGAVDPARFQGLPGVK 60 Query: 61 SVVRVLKPYKLVSREFHPEDTVIDLGDVKIGNGYFTIIAGPCSVEGREMLMETAHFLSEL 120 ++ V +PYKLVSRE PE+TV+ +GDV IG G ++AGPC+VE E M + E Sbjct: 61 ELIPVTRPYKLVSRETKPENTVVRMGDVAIGEGRPVLMAGPCAVENLEQCMAIGKSVKES 120 Query: 121 GVKVLRGGAYKPRTSPYSFQGLGEKGLEYLREAADKYGMYVVTEALGEDDLPKVAEYADI 180 G ++ RGGA+KPRTSPYSFQGLGE+GL+ L ++ G+ +VTE + + V EY+D+ Sbjct: 121 GAEMFRGGAFKPRTSPYSFQGLGEEGLKILAAVREETGLKIVTEVMDNETFDLVEEYSDM 180 Query: 181 IQIGARNAQNFRLLSKAGSYNKPVLLKRGFMNTIEEFLLSAEYIANSGNTKIILCERGIR 240 +QIG RN QNF LL +AG KPV+LKRG TI+E+L++AEYI GN +I+LCERGIR Sbjct: 181 VQIGTRNMQNFALLRRAGLAKKPVMLKRGMSATIDEWLMAAEYIMERGNDQIVLCERGIR 240 Query: 241 TFEKATRNTLDISAVPIIRKESHLPILVDPSHSGGRRDLVIPLSRAAIAVGAHGIIVEVH 300 TF +RNTLD+SA+ ++RKESHLPI+ DPSH+GG R V PL+RA+ A+G G+++EVH Sbjct: 241 TFAMHSRNTLDLSAITVVRKESHLPIITDPSHAGGHRCQVGPLARASAAMGVDGMMIEVH 300 Query: 301 PEPEKALSDGKQSLDFELFKELVQEMKKLAD 331 +P ALSDG QSL F +L Q++ + D Sbjct: 301 NDPAAALSDGGQSLYPHQFSKLAQQIFDIHD 331 Lambda K H 0.318 0.138 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 321 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 339 Length adjustment: 28 Effective length of query: 310 Effective length of database: 311 Effective search space: 96410 Effective search space used: 96410 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_028313202.1 G491_RS0100580 (3-deoxy-7-phosphoheptulonate synthase)
to HMM TIGR01361 (aroF: 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01361.hmm # target sequence database: /tmp/gapView.3465543.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01361 [M=260] Accession: TIGR01361 Description: DAHP_synth_Bsub: 3-deoxy-7-phosphoheptulonate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-120 387.0 0.0 2.4e-120 386.7 0.0 1.1 1 NCBI__GCF_000429905.1:WP_028313202.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000429905.1:WP_028313202.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 386.7 0.0 2.4e-120 2.4e-120 2 257 .. 71 326 .. 70 329 .. 0.99 Alignments for each domain: == domain 1 score: 386.7 bits; conditional E-value: 2.4e-120 TIGR01361 2 laskkvkkeetvvdvedvkiGegeliviaGPCsveseeqivetakavkeaGakllrGgafkPrtsPysfqGlg 74 l+s+++k+e+tvv++ dv+iGeg+++++aGPC+ve+ eq ++++k+vke Ga+++rGgafkPrtsPysfqGlg NCBI__GCF_000429905.1:WP_028313202.1 71 LVSRETKPENTVVRMGDVAIGEGRPVLMAGPCAVENLEQCMAIGKSVKESGAEMFRGGAFKPRTSPYSFQGLG 143 789********************************************************************** PP TIGR01361 75 eeglkllkrakdetgllvvtevlderdveivaeyvDilqiGarnmqnfelLkevgkskkPvlLkrglaatiee 147 eeglk+l+++++etgl++vtev+d++ +++v+ey D++qiG+rnmqnf+lL+++g +kkPv+Lkrg++ati+e NCBI__GCF_000429905.1:WP_028313202.1 144 EEGLKILAAVREETGLKIVTEVMDNETFDLVEEYSDMVQIGTRNMQNFALLRRAGLAKKPVMLKRGMSATIDE 216 ************************************************************************* PP TIGR01361 148 wleaaeYilsegnenvilcerGirtfekatrftldlsavallkklthlPvivDpshaaGrrdlvlplakaava 220 wl+aaeYi+++gn +++lcerGirtf r+tldlsa+++++k++hlP+i Dpsha G+r v pla+a+ a NCBI__GCF_000429905.1:WP_028313202.1 217 WLMAAEYIMERGNDQIVLCERGIRTFAMHSRNTLDLSAITVVRKESHLPIITDPSHAGGHRCQVGPLARASAA 289 ************************************************************************* PP TIGR01361 221 vGadgllievhpdPekalsDseqqltpeefkelvkel 257 +G dg++ievh+dP+ alsD+ q+l p++f++l +++ NCBI__GCF_000429905.1:WP_028313202.1 290 MGVDGMMIEVHNDPAAALSDGGQSLYPHQFSKLAQQI 326 ********************************99987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (260 nodes) Target sequences: 1 (339 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 24.13 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory