Align Homoisocitrate dehydrogenase; HICDH; Homo(2)-isocitrate/homo(3)-isocitrate dehydrogenase; Isohomocitrate dehydrogenase; IHDH; NAD-dependent threo-isohomocitrate dehydrogenase; EC 1.1.1.87; EC 1.1.1.- (characterized)
to candidate WP_012610379.1 G491_RS0123945 3-isopropylmalate dehydrogenase
Query= SwissProt::Q58991 (347 letters) >NCBI__GCF_000429905.1:WP_012610379.1 Length = 359 Score = 211 bits (536), Expect = 3e-59 Identities = 136/363 (37%), Positives = 202/363 (55%), Gaps = 29/363 (7%) Query: 3 KVCVIEGDGIGKEVIPEAIKILNELGE-----FEIIKGEAGLECLKKYGNALPEDTIEKA 57 K+ ++ GDG G EV+ E +K+L GE +E ++ G E K G+ L ++T++ Sbjct: 6 KIAIVGGDGTGPEVVAEGVKVLKAAGERGNISYEFVEFPLGGENYMKTGDLLTQETLDSL 65 Query: 58 KEADIILFGAITSP--KPGEVKNYKSPIITLRKMFHLYANVRPINNFGIGQLIGKIADYE 115 K D I GAI P KPG ++ K ++ LR Y N+RP+ + G + Sbjct: 66 KTMDAIYLGAIGHPDVKPGILE--KGILLDLRFSLDQYINLRPVKLYE-----GVDTPLK 118 Query: 116 FLNAKNIDIVIIRENTEDLYVG-----RERLENDTAIAERVITRKGSERIIRFAFEYAIK 170 ++ID V++RENTE LY G ++ ++ A+ E + TRKG+ER IR+AFEY K Sbjct: 119 DKGPEDIDFVVVRENTEGLYAGAGGVLKKGTLDEVAVQESINTRKGAERCIRYAFEYCQK 178 Query: 171 NNRKK---VSCIHKANVLRITDGLFLEVFNEIKKHY-NIEADDYLVDSTAMNLIKHPEKF 226 N KK V+ K NVL L+ VF E+ K Y +IEAD VD+T M ++K+PE F Sbjct: 179 RNNKKGKKVTLCGKTNVLTFAFDLWERVFYEVAKEYPDIEADYAHVDATCMWMVKNPEWF 238 Query: 227 DVIVTTNMFGDILSDEASALIGGLGLAPSANIG-DDKALFEPVHGSAPDIAGKGIANPMA 285 DVIVT NMFGDI++D + + GG+G+A NI + ++FEP+ GSAP G GI NP+A Sbjct: 239 DVIVTDNMFGDIITDLGAMIQGGMGIAAGGNINPEGVSMFEPIGGSAPKYTGMGIINPIA 298 Query: 286 SILSIAMLFDYIGEKEKGDLIREAVKYCLINKKVTPDLGG---DLKTKDVGDEILNYIRK 342 +I + ++ D +GE E I + + L + DLG T +VGD I ++++ Sbjct: 299 AIGAGQIMLDTLGETEAASWIEQGIIKVL--RDDLKDLGAGKMGFSTSEVGDLIADFVKN 356 Query: 343 KLK 345 K Sbjct: 357 SAK 359 Lambda K H 0.319 0.140 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 389 Number of extensions: 30 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 359 Length adjustment: 29 Effective length of query: 318 Effective length of database: 330 Effective search space: 104940 Effective search space used: 104940 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory