Align Bifunctional chorismate mutase/prephenate dehydratase; Chorismate mutase-prephenate dehydratase; P-protein; EC 5.4.99.5; EC 4.2.1.51 (characterized)
to candidate WP_028315507.1 G491_RS0117450 prephenate dehydratase
Query= SwissProt::P27603 (365 letters) >NCBI__GCF_000429905.1:WP_028315507.1 Length = 365 Score = 290 bits (742), Expect = 4e-83 Identities = 155/356 (43%), Positives = 224/356 (62%), Gaps = 6/356 (1%) Query: 6 QLKALRVRIDSLDERILDLISERARCAQEVARVKTASWPKAEEAVFYRPEREAWVLKHIM 65 +L+ LR I+ D++IL L++ER AQ++ +K K V + ER VL + Sbjct: 11 ELEPLRQAINETDQKILALVNERLDIAQKIGAIKQG---KGLPVVDFSRERA--VLNKLQ 65 Query: 66 ELNKGPLDNEEMARLFREIMSSCLALEQPLRVAYLGPEGTFSQAAALKHFGHSVISKPMA 125 ELN+GP+ +E + L+ EI+++ ++QPL V YLGP+ TF+ AA+KHFG S P+A Sbjct: 66 ELNEGPMPDETLLLLYTEIIAASRRIQQPLEVGYLGPKATFTHMAAMKHFGRSTNFTPLA 125 Query: 126 AIDEVFREVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDIVICGEVELRIHHHLLVGET 185 I +VF EV FGVVPVENS EGAVN TLD F E D+ ICGE+ L I H LL E Sbjct: 126 TISDVFEEVDKRRRPFGVVPVENSMEGAVNLTLDLFQESDVRICGEIYLPIRHDLLSAED 185 Query: 186 TKTDRITRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAAKRVKSEWNSAAIAGDMAA 245 + D+I ++SH Q++AQCRKWL + P + + SS ++AA+ + AAIA AA Sbjct: 186 S-LDQIMVVFSHPQAIAQCRKWLGKNLPGILQNQCSSTSEAARMAVNTPGGAAIASSEAA 244 Query: 246 QLYGLSKLAEKIEDRPVNSTRFLIIGSQEVPPTGDDKTSIIVSMRNKPGALHELLMPFHS 305 Y L+ LA+ I+D N TRFL+IG +V PTG DKTS++ ++ + PGALH +L P Sbjct: 245 ITYELNTLADNIQDSTTNITRFLVIGRDKVQPTGRDKTSLLFAIPHIPGALHSVLQPISE 304 Query: 306 NGIDLTRIETRPSRSGKWTYVFFIDCMGHHQDPLIKNVLEKIGHEAVALKVLGSYP 361 G+++ ++E+RPS+S W Y+FF+D GH +D +K V++K+ +K +GSYP Sbjct: 305 EGLNMVKLESRPSKSASWHYLFFVDLEGHMKDEPVKKVVDKMRSLCSFVKWMGSYP 360 Lambda K H 0.319 0.133 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 338 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 365 Length adjustment: 30 Effective length of query: 335 Effective length of database: 335 Effective search space: 112225 Effective search space used: 112225 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory