Align 3-isopropylmalate dehydratase small subunit; EC 4.2.1.33 (characterized, see rationale)
to candidate WP_029000320.1 H537_RS0126785 3-isopropylmalate dehydratase small subunit
Query= uniprot:Q845W4 (216 letters) >NCBI__GCF_000430725.1:WP_029000320.1 Length = 215 Score = 344 bits (883), Expect = e-100 Identities = 161/212 (75%), Positives = 181/212 (85%) Query: 1 MEKFTVHTGVVAPLDRENVDTDAIIPKQFLKSIKRTGFGPNAFDEWRYLDHGEPGQDNSK 60 M+ FTVH G+VAP+DRENVDTDAIIPKQFLKSIKRTGFGPN FDEWRYLDHGEPGQD + Sbjct: 1 MQAFTVHQGLVAPMDRENVDTDAIIPKQFLKSIKRTGFGPNLFDEWRYLDHGEPGQDIAT 60 Query: 61 RPLNPDFVLNQPRYQGASILVTRKNFGCGSSREHAPWALQQYGFRAIIAPSFADIFFNNC 120 R NPDFVLNQPRY GASIL+ R+NFGCGSSREHAPWAL+Q+GFRA+IAPSFADIFFNNC Sbjct: 61 RKPNPDFVLNQPRYAGASILLARRNFGCGSSREHAPWALEQFGFRALIAPSFADIFFNNC 120 Query: 121 FKNGLLPIVLTEQQVDHLINETVAFNGYQLTIDLEAQVVRTPDGRDYPFEITAFRKYCLL 180 FKNGLLP+VL E +VD L ++ AF G QLTIDL Q V PDG + F++ FRKYCL+ Sbjct: 121 FKNGLLPVVLPEHEVDKLFDDVAAFPGLQLTIDLPRQRVVRPDGTELEFDVQPFRKYCLV 180 Query: 181 NGFDDIGLTLRHADKIRQFEAERLAKQPWLNN 212 NGFDDIGLTLRHA+KI +FE ERLA+ PWL N Sbjct: 181 NGFDDIGLTLRHAEKIARFEGERLARMPWLAN 212 Lambda K H 0.322 0.141 0.437 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 243 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 216 Length of database: 215 Length adjustment: 22 Effective length of query: 194 Effective length of database: 193 Effective search space: 37442 Effective search space used: 37442 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
Align candidate WP_029000320.1 H537_RS0126785 (3-isopropylmalate dehydratase small subunit)
to HMM TIGR00171 (leuD: 3-isopropylmalate dehydratase, small subunit (EC 4.2.1.33))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00171.hmm # target sequence database: /tmp/gapView.1970561.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00171 [M=188] Accession: TIGR00171 Description: leuD: 3-isopropylmalate dehydratase, small subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.9e-86 272.9 0.0 8.1e-86 272.7 0.0 1.0 1 NCBI__GCF_000430725.1:WP_029000320.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000430725.1:WP_029000320.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 272.7 0.0 8.1e-86 8.1e-86 1 188 [] 1 196 [. 1 196 [. 0.95 Alignments for each domain: == domain 1 score: 272.7 bits; conditional E-value: 8.1e-86 TIGR00171 1 mkefkkltGlvvpldkanvdtdaiipkqflkkikrtGfgkhlfyewrylde..kG.....kepnpefvlnvpq 66 m+ f ++Glv+p+d+ nvdtdaiipkqflk ikrtGfg +lf ewryld+ G ++pnp+fvln+p+ NCBI__GCF_000430725.1:WP_029000320.1 1 MQAFTVHQGLVAPMDRENVDTDAIIPKQFLKSIKRTGFGPNLFDEWRYLDHgePGqdiatRKPNPDFVLNQPR 73 889*********************************************985323422222689********** PP TIGR00171 67 yqgasillarenfGcGssrehapwalkdyGfkviiapsfadifynnsfkngllpirlseeeveellalvk.nk 138 y gasillar nfGcGssrehapwal+++Gf+ +iapsfadif+nn+fkngllp+ l+e+ev++l+ v+ + NCBI__GCF_000430725.1:WP_029000320.1 74 YAGASILLARRNFGCGSSREHAPWALEQFGFRALIAPSFADIFFNNCFKNGLLPVVLPEHEVDKLFDDVAaFP 146 *********************************************************************989* PP TIGR00171 139 glkltvdleaqkvkdsegkvysfeidefrkhcllnGldeigltlqkedei 188 gl+lt+dl+ q+v +g +f++++frk cl+nG+d+igltl++ ++i NCBI__GCF_000430725.1:WP_029000320.1 147 GLQLTIDLPRQRVVRPDGTELEFDVQPFRKYCLVNGFDDIGLTLRHAEKI 196 **********************************************9987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (188 nodes) Target sequences: 1 (215 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 15.75 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory