Align Histidinol-phosphatase (EC:3.1.3.15) (characterized)
to candidate WP_028313072.1 H566_RS0121585 HAD family hydrolase
Query= reanno::BFirm:BPHYT_RS03625 (228 letters) >NCBI__GCF_000482785.1:WP_028313072.1 Length = 221 Score = 254 bits (649), Expect = 9e-73 Identities = 123/224 (54%), Positives = 160/224 (71%), Gaps = 4/224 (1%) Query: 3 NLALFDLDHTLIPTDSDHEWGRFMVKHGMVDAENFARENDRFFADYKAGKLDIHAYLIAM 62 NL LFDLD+TL+P DSD+EWG+F+V+ G+VDAE + N+RFF Y G LDI +L + Sbjct: 2 NLTLFDLDNTLLPIDSDYEWGQFLVRTGIVDAEEYRVANERFFEQYNDGTLDIFEFLHFV 61 Query: 63 LTPLSKYTRAQLADFHAQYMHEVIKPAIFPVALELVKQHRETGDLCCVVTATNEFITRPI 122 L PL K RA+L HA+YM EVI P + P AL+LV++HR+ GDLC +VTATN FITRPI Sbjct: 62 LRPLVKLDRAELDALHARYMTEVIAPNLRPAALDLVRRHRDAGDLCAIVTATNSFITRPI 121 Query: 123 AQAFGVDALIACEAETVDGEPHSPYTGRPTGTPSYKEGKIVRTEAWLASLGKTWSDFERS 182 A+AFG+ LIA E + VDG +TG + P +K+GKI RTEAWLA+ G WS F + Sbjct: 122 ARAFGITELIATEFDEVDGR----FTGEISVAPCFKDGKIARTEAWLAARGLDWSSFGNT 177 Query: 183 YFYSDSHNDIPLLEKVTDPIATNPDDTLRAHAQAKGWRILELFQ 226 FYSDS ND+PL+++V P+A NP LR HA A+GW ++ELF+ Sbjct: 178 TFYSDSANDLPLMQRVKQPVAVNPSGRLRDHALAEGWPVIELFR 221 Lambda K H 0.320 0.135 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 187 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 228 Length of database: 221 Length adjustment: 22 Effective length of query: 206 Effective length of database: 199 Effective search space: 40994 Effective search space used: 40994 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory