Align Histidine biosynthesis trifunctional protein; EC 3.5.4.19; EC 3.6.1.31; EC 1.1.1.23 (characterized)
to candidate WP_028486080.1 B076_RS0103505 histidinol dehydrogenase
Query= SwissProt::P00815 (799 letters) >NCBI__GCF_000483485.1:WP_028486080.1 Length = 433 Score = 256 bits (655), Expect = 1e-72 Identities = 153/406 (37%), Positives = 231/406 (56%), Gaps = 13/406 (3%) Query: 387 LVNPIIENVRDKGNSALLEYTEKFDGVKL-SNPVLNAPFP--EEYFEGLTEEMKEALDLS 443 +V ++ NVR +G++ALLEYTE+FD + L S L P ++ + + E +EAL+LS Sbjct: 35 IVKEVVNNVRTQGDAALLEYTERFDRLALKSGAELEIPMERIQKALQTIPAEQREALELS 94 Query: 444 IENVRKFHAAQLPTETLEVETQPGVLCSRFPRPIEKVGLYIPGGTAILPSTALMLGVPAQ 503 E V+ +H Q+ TE+ G + + P++ VGLY+PGG A PS+ +M +PA+ Sbjct: 95 AERVKAYHQKQV-TESWNYTEADGTMLGQQVTPLDSVGLYVPGGKAAYPSSVIMNAIPAK 153 Query: 504 VAQCKEIVFASPPRKSDGKVSPEVVYVAEKVGASKIVLAGGAQAVAAMAYGTETIPKVDK 563 VA + ++ P DG+V+ V+ A ++ GGAQAVAA+AYGT+T+P VDK Sbjct: 154 VAGVETLIMVVPT--PDGEVNDMVLAAAAICDVDRVFTLGGAQAVAALAYGTQTVPAVDK 211 Query: 564 ILGPGNQFVTAAKMYVQNDTQALCSIDMPAGPSEVLVIADEDADVDFVASDLLSQAEHGI 623 I+GPGN FV AK V IDM AGPSE+LV D + D++A DL SQAEH Sbjct: 212 IVGPGNIFVATAKRMVFGTV----GIDMIAGPSEILVYCDGKTNPDWIAVDLFSQAEHDE 267 Query: 624 DSQVILVGVNLSEKKIQEIQDAVHNQALQLPRVDIVRKCIA-HSTIVLCDGYEEALEMSN 682 D+Q ILV + +++ ++++ +PR +I+RK + I++ + +ALEM N Sbjct: 268 DAQSILV--TQDAEFAEKVYESMNRLLPTMPRQEIIRKALDDRGAIIVVNDESQALEMIN 325 Query: 683 QYAPEHLILQIANANDYVKLVDNAGSVFVGAYTPESCGDYSSGTNHTLPTYGYARQYSGA 742 APEHL L + + + + +AG++F+G YT E+ GDY +G NH LPT AR S Sbjct: 326 IIAPEHLELSVEDPKALLPKIRHAGAIFMGRYTAEALGDYCAGPNHVLPTSRTARFSSPL 385 Query: 743 NTATFQKFITAQNITPEGLENIGRAVMCVAKKEGLDGHRNAVKIRM 788 FQK + + EG +G+ +A EGL H + + R+ Sbjct: 386 GVYDFQKRSSLIMCSEEGANVLGKVAGVLADGEGLQAHAASARYRV 431 Lambda K H 0.315 0.133 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 774 Number of extensions: 44 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 799 Length of database: 433 Length adjustment: 37 Effective length of query: 762 Effective length of database: 396 Effective search space: 301752 Effective search space used: 301752 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory