Align [LysW]-aminoadipate kinase; EC 2.7.2.17 (uncharacterized)
to candidate WP_211230195.1 B076_RS0101775 acetylglutamate kinase
Query= curated2:Q9RUG6 (292 letters) >NCBI__GCF_000483485.1:WP_211230195.1 Length = 298 Score = 115 bits (288), Expect = 1e-30 Identities = 82/275 (29%), Positives = 137/275 (49%), Gaps = 17/275 (6%) Query: 27 IVVKVGGSDGIDY---DAVCADLAERWQAGEKLILVHGGSGETNRVAEALGHPPKFVTSP 83 IVVK GG+ ID + D+ G ++VHGG + + + +G +F+ Sbjct: 30 IVVKYGGNAMIDEKLKEGFARDIVLMKLVGINPVVVHGGGPQIGDLLKRVGKESEFIQG- 88 Query: 84 SGYTSRFTDRQTLEIFEMVYCGKMNKGLVERLQRLGVNAVGLSGLDGRIFEGKHKD-SVR 142 R TD +T++I EMV G++NK +V + R G N+VGL+G DG + K + Sbjct: 89 ----MRVTDTETMDIVEMVLGGQVNKEIVNLIHRHGGNSVGLTGKDGNLICAKKMHMELN 144 Query: 143 SVENGKVKVLRGDHTGTVEKVNTGLIELLLGAGYLPVLTPPAASYEGVAINVDGDRAAAQ 202 + E +++ H G VEK+NT ++++L+ ++PV+ P +G + N++ D A + Sbjct: 145 APELNAPEIIDLGHVGEVEKINTQVLDMLIQGDFIPVIAPVGVGKDGHSYNINADLVAGK 204 Query: 203 LAAALRAEALLLLSNVPGLLRDYPDEASLIREIPANDVESYL--EFAQDRMKKKVLGAAE 260 +A AL AE L+LL+N GLL E +L+ + A V+ + M K+ A + Sbjct: 205 VAEALNAEKLMLLTNTAGLL---DKEGNLLTGLTAKKVDELIGDGTIYGGMLPKIRCALD 261 Query: 261 AVAGGVGRVVFGDARAGKPISAAL---AGEGTVVS 292 AV GV D R + + G GT+++ Sbjct: 262 AVQNGVHSAHIIDGRVEHAVMLEVFTDEGVGTLIT 296 Lambda K H 0.319 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 212 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 298 Length adjustment: 26 Effective length of query: 266 Effective length of database: 272 Effective search space: 72352 Effective search space used: 72352 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory