Align Homoserine O-acetyltransferase; HAT; Homoserine transacetylase; HTA; EC 2.3.1.31 (characterized)
to candidate WP_024850420.1 N745_RS0101730 homoserine O-acetyltransferase
Query= SwissProt::D7E9E0 (489 letters) >NCBI__GCF_000526715.1:WP_024850420.1 Length = 386 Score = 389 bits (1000), Expect = e-113 Identities = 196/385 (50%), Positives = 265/385 (68%), Gaps = 11/385 (2%) Query: 5 SIGNVETKYYQIPEELVLESGKKISDVTLAYETYGTLNWDKSNAILVCHALTGDAHAAGW 64 S+G V ++ I L + G + + LA+ETYG LN D SNAIL+CHAL+G H AG+ Sbjct: 3 SVGIVHSQTLHISTPLNMVCGSVLPEYDLAFETYGELNDDHSNAILICHALSGHQHVAGF 62 Query: 65 HEGDRKPGWWDIIIGPGKALDTRKYFIICSNVIGGCKGSTGPSSINPDTGESYGLDFPVV 124 HEGD+ GWWD IGPGK +DT ++F++CSN +GGC GS+GP+SINP+TG+ YG DFP+V Sbjct: 63 HEGDKDAGWWDSYIGPGKVIDTDRFFVVCSNNLGGCHGSSGPTSINPETGQVYGPDFPIV 122 Query: 125 TIKDMVNAQKKLIDYLGISKLLAVIGGSMGGLQVLQWSVSYPDMVKKAIPIATAGYSTPQ 184 T KD VN+Q +L YL I A+IGGSMGG+QV+QW++ YPD +K A+ IA+A + Q Sbjct: 123 TCKDWVNSQNELRKYLKIEAWAAIIGGSMGGMQVMQWAIDYPDKIKHAVVIASAPKLSAQ 182 Query: 185 QIAFNEVGRIAIVSDPNWNSGNYYGEK-EPTHGLALARMIGHITYLSDDSMHQKFGRRLQ 243 IAFNEV R AI++DP++ G + + P GLALARM+GH+TYLSDD M KFGR L+ Sbjct: 183 NIAFNEVARRAIMTDPDFLDGRFIEKNTTPKRGLALARMLGHLTYLSDDLMGTKFGRELR 242 Query: 244 DKNEYEFDFSREFEVESYLHYQGLTFT--ERFDANSYLYLTKAIDYFDLTE--NNSLAEG 299 + + +++ EF+VESYL YQG F + FDAN+YL +TKA+DYFD +N L + Sbjct: 243 E-GKLNYNYEVEFQVESYLRYQGEKFATKQNFDANTYLLMTKALDYFDPASEYDNDLTKA 301 Query: 300 LKNVEAKFLVISFTSDWLYPPYQLREIVMALSANNADVTYREIESNYGHDSFLLESGQLN 359 L + +AKFLVISFT+DW + P + EIV AL N+ADV+Y EIES +GHD+FLL + Sbjct: 302 LSHAKAKFLVISFTTDWRFAPERSHEIVKALLDNDADVSYAEIESKHGHDAFLLPNPHYE 361 Query: 360 YVLNNFLSHTYVSDIMIEDIATIKE 384 V Y++ ++ DIA + E Sbjct: 362 NVF-----RAYLNQVVCRDIAPVPE 381 Lambda K H 0.316 0.134 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 610 Number of extensions: 36 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 489 Length of database: 386 Length adjustment: 32 Effective length of query: 457 Effective length of database: 354 Effective search space: 161778 Effective search space used: 161778 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
Align candidate WP_024850420.1 N745_RS0101730 (homoserine O-acetyltransferase)
to HMM TIGR01392 (metX: homoserine O-acetyltransferase (EC 2.3.1.31))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01392.hmm # target sequence database: /tmp/gapView.3861264.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01392 [M=351] Accession: TIGR01392 Description: homoserO_Ac_trn: homoserine O-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.1e-143 462.1 0.0 7e-143 461.9 0.0 1.0 1 NCBI__GCF_000526715.1:WP_024850420.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000526715.1:WP_024850420.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 461.9 0.0 7e-143 7e-143 3 350 .. 16 368 .. 14 369 .. 0.97 Alignments for each domain: == domain 1 score: 461.9 bits; conditional E-value: 7e-143 TIGR01392 3 eeltlesGevlsevevayktyGtlnaerdNavlvcHaltgsahvagkadeedk.GWWdellGpgraldtsryf 74 ++l++ +G+vl+e+++a++tyG+ln++++Na+l+cHal+g++hvag ++ +++ GWWd+++Gpg+ +dt+r+f NCBI__GCF_000526715.1:WP_024850420.1 16 TPLNMVCGSVLPEYDLAFETYGELNDDHSNAILICHALSGHQHVAGFHEGDKDaGWWDSYIGPGKVIDTDRFF 88 679999****************************************99977768******************* PP TIGR01392 75 vvclNvlGsckGstgPlsinpetgkpygaefPlvtirDlvkaqkalldsLgveklaavvGgSlGGmqalewal 147 vvc+N+lG+c+Gs+gP+sinpetg+ yg++fP vt +D+v+ q++l + L +e +aa++GgS+GGmq+++wa+ NCBI__GCF_000526715.1:WP_024850420.1 89 VVCSNNLGGCHGSSGPTSINPETGQVYGPDFPIVTCKDWVNSQNELRKYLKIEAWAAIIGGSMGGMQVMQWAI 161 ************************************************************************* PP TIGR01392 148 sypervkkivvlatsarasaqaiafnevqrqailsDpeyndGeyaeee.qPekGLalARmlalltYrseesle 219 +yp+++k++vv+a+++++saq+iafnev+r+ai++Dp++ dG++ e++ +P++GLalARml++ltY+s++ + NCBI__GCF_000526715.1:WP_024850420.1 162 DYPDKIKHAVVIASAPKLSAQNIAFNEVARRAIMTDPDFLDGRFIEKNtTPKRGLALARMLGHLTYLSDDLMG 234 *********************************************9999************************ PP TIGR01392 220 erfgreakseeslassleeefsvesylryqgkkfver..FdAnsYllltkaldthdlargrrdslkealkkik 290 ++fgre ++ +l++++e ef+vesylryqg+kf+++ FdAn+Yll+tkald++d a +++++l++al+++k NCBI__GCF_000526715.1:WP_024850420.1 235 TKFGRELREG-KLNYNYEVEFQVESYLRYQGEKFATKqnFDANTYLLMTKALDYFDPASEYDNDLTKALSHAK 306 *******999.78999******************96444********************************** PP TIGR01392 291 apvlvvgiesDllftleeqeelakalkaakle..yaeieseeGHDaFllekekveelirefl 350 a++lv+++++D++f++e+++e++kal +++++ yaeies++GHDaFll + ++e++ r++l NCBI__GCF_000526715.1:WP_024850420.1 307 AKFLVISFTTDWRFAPERSHEIVKALLDNDADvsYAEIESKHGHDAFLLPNPHYENVFRAYL 368 **************************98888778********************99998876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (386 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 15.95 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory