Align Aspartate/prephenate aminotransferase; AspAT / PAT; EC 2.6.1.1; EC 2.6.1.79 (characterized)
to candidate WP_024850483.1 N745_RS0102095 pyridoxal phosphate-dependent aminotransferase
Query= SwissProt::Q82WA8 (397 letters) >NCBI__GCF_000526715.1:WP_024850483.1 Length = 396 Score = 472 bits (1215), Expect = e-138 Identities = 236/395 (59%), Positives = 299/395 (75%), Gaps = 6/395 (1%) Query: 2 KLSQRVQAIKPSPTLAVTAKAARLKAEGKNIIGLGAGEPDFDTPLHIKDAAITAIRNGFT 61 +LS RV +KPS TL +TAKAA L+ G+NII LGAGEPDF TP HIK A I AI T Sbjct: 6 RLSDRVNRVKPSLTLVITAKAAELRRAGRNIISLGAGEPDFGTPDHIKAAGIKAIETEHT 65 Query: 62 KYTAVGGTASLKQAIISKFKRENSLEFMPGEILVSSGGKQSFFNLVLATIDPGDEVIIPA 121 +YTAV G LK AII+KFKR+N L+F +ILVSSGGKQSF+NL ++ GDEVIIPA Sbjct: 66 RYTAVDGIPELKDAIIAKFKRDNKLDFEANQILVSSGGKQSFYNLCQGVLNDGDEVIIPA 125 Query: 122 PYWVSYPDIVLIAEGKPVFIDTGIEEKFKISPDQLEKAITPRTRMFVVNSPSNPSGSVYS 181 PYWVSYPD+ L+A G+PV I+ GIE+ FK++ QLE AITP+T+MFV+NSPSNP+G++YS Sbjct: 126 PYWVSYPDMALLAGGEPVIIEAGIEQGFKVTAAQLEAAITPKTKMFVLNSPSNPTGAIYS 185 Query: 182 LEELQALGAVLRKYPDILIATDDMYEHILLSGDGFVNILNACPDLKARTVVLNGVSKAYA 241 EEL+A+G VL K+P+I+IA+DDMYEHILLS F NIL CP+L RTVV+NGVSKAY+ Sbjct: 186 AEELKAIGDVLAKHPNIIIASDDMYEHILLSDMPFTNILQVCPELTDRTVVMNGVSKAYS 245 Query: 242 MTGWRIGYCGGPAAIITAMENIQSQSTSNPNSIAQVAAEAALNGDQSCMVPMIEAFRERN 301 MTGWRIGY GGP +I AM +QSQSTSNP SI+Q A+ AL+G Q C+ M++AF+ER+ Sbjct: 246 MTGWRIGYAGGPVDLIAAMRKVQSQSTSNPCSISQYASVEALDGPQECIQVMLKAFKERH 305 Query: 302 QFLTNALNSIAGIHCLLSEGAFYAFVDVRQAISRLNTQQILQNSSDIAFCNYVLEKAEVA 361 +F+ +N I G C+ + GAFYAF+DV++AI ++ SD F +LE+ +VA Sbjct: 306 EFVVERINQIPGFKCIPAAGAFYAFMDVKEAI------KMKGFDSDADFATAILEQVDVA 359 Query: 362 AVPGSAFGCEGYMRLSFATSMDNLQEAVKRIASLL 396 AVPGS FG EGY+R+SFATSM+NL EA+ RI S + Sbjct: 360 AVPGSGFGSEGYLRISFATSMENLVEALNRIDSFM 394 Lambda K H 0.318 0.133 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 428 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 396 Length adjustment: 31 Effective length of query: 366 Effective length of database: 365 Effective search space: 133590 Effective search space used: 133590 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory