Align cystathionine gamma-lyase (EC 4.4.1.1); cysteine-S-conjugate beta-lyase (EC 4.4.1.13) (characterized)
to candidate WP_025272347.1 HALAL_RS0101720 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme
Query= BRENDA::A2RM21 (380 letters) >NCBI__GCF_000527155.1:WP_025272347.1 Length = 380 Score = 215 bits (547), Expect = 2e-60 Identities = 149/388 (38%), Positives = 212/388 (54%), Gaps = 31/388 (7%) Query: 6 TKVIHGGISTDKTTGAVSVPIYQTSTYK------------QNGLGQPKEYE--YSRSGNP 51 T+ +H G G PI ++TY Q GQ + Y+R NP Sbjct: 7 TRAVHAGREDLLEAGVHVPPIDLSTTYPAVDSAAEAERMDQYAAGQQPDGSPIYARLHNP 66 Query: 52 TRHALEELIADLEGGVQGFAFSSGLAGIHAVLSLFSAGD--HIILADDVYGGTFRLMDKV 109 T E+ +A+LE AF+SG+A + A L ++G I+ VYGGT D V Sbjct: 67 TVARFEKALAELEHSEAAVAFASGMAAMSASLLAATSGGKREIVAVRPVYGGT----DLV 122 Query: 110 LTKTGIIYDLVDLSNLDDLKAAFKEETKAIYFETPSNPLLKVLDIKEISAIAKAHDALTL 169 L+ TG++ V ++ D + A T + ETP+NP L L I++I+ D L Sbjct: 123 LS-TGLLGTEVTWTDADSVADAITSNTALVIVETPANPTLHELSIRDIATACG--DVPLL 179 Query: 170 VDNTFATPYLQQPIALGADIVLHSATKYLGGHSDVVAGLVTTNSKELASEIGFLQNSIGA 229 VDNT ATP LQ PI GA I LHSATK LGG+ DVV G+V + + A ++ ++ + G Sbjct: 180 VDNTLATPALQNPIREGASIALHSATKALGGYGDVVGGVVACD-EAFAQKMRSVRIATGG 238 Query: 230 VLGPQDSWLVQRGIKTLALRMEAHSANAQKIAEFLETSKAVSKVYYPGLNSHPGHEIAKK 289 VL P ++++QRG+ TL LR+E S A +A L+ VS V+YPGLNS+ Sbjct: 239 VLHPLAAYMLQRGLATLPLRVERMSRTAHDLAVRLQDDPRVSAVHYPGLNSN-----RPS 293 Query: 290 QMSAFGGMISFELTDENAVKDFVENLSYFTLAESLGGVESLIEVPAVMTHASIPKELREE 349 QM++ G M+SFE T++ +D ++ +S T A SLG V+SLI+ PA +TH + + RE Sbjct: 294 QMTSGGTMVSFETTED--ARDVIKKVSLITPAVSLGSVDSLIQHPASLTHHVVDPDARET 351 Query: 350 IGIKDGLIRLSVGVEAIEDLLTDIKEAL 377 GI D LIRLSVG+E+ +DL D+ AL Sbjct: 352 CGISDHLIRLSVGLESPDDLWADLDTAL 379 Lambda K H 0.315 0.133 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 374 Number of extensions: 23 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 380 Length of database: 380 Length adjustment: 30 Effective length of query: 350 Effective length of database: 350 Effective search space: 122500 Effective search space used: 122500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory