Align O-phosphoserine sulfhydrylase monomer (EC 2.5.1.47; EC 2.5.1.65) (characterized)
to candidate WP_025273295.1 HALAL_RS0106885 2,3-diaminopropionate biosynthesis protein SbnA
Query= metacyc::MONOMER-20568 (299 letters) >NCBI__GCF_000527155.1:WP_025273295.1 Length = 321 Score = 130 bits (327), Expect = 4e-35 Identities = 93/307 (30%), Positives = 146/307 (47%), Gaps = 21/307 (6%) Query: 1 MIYDNILETIGNTPLVRINHLNPNPKVQMYAKLEGFNPTGSVKDRIALKMIEQAEAEGKL 60 M+Y+++ E I T + +N + P+ Q++ KLEG NP+GS+K + A ++E AE G+L Sbjct: 1 MLYNDVSEII--TDDIFVNLKDFLPQRQVFLKLEGLNPSGSIKAKAAASLLEDAEKSGRL 58 Query: 61 HPGSTIIEATSGNTGIGLAMIGRVKGYNVIIVMSEGVSIERRKMIKAFGAEIILTDKKLG 120 PG IIE++SGN GI L+ KGY + IV V + ++A G + + ++ Sbjct: 59 GPGKKIIESSSGNLGIALSTACAAKGYPLTIVTDANVQESALRTMRALGTRLTIIERPDS 118 Query: 121 TDGAIRK----VAELVKENPGKYFNPNQFSNEYNKIAHYKTTAEEIWAQTKGTVTHFVAA 176 T G + + + + ++P + NQ+SN N AH TTA + G + Sbjct: 119 TGGFLHQRIDYIHRSLNDDPDLVW-LNQYSNPANVWAHTATTAHAV-DNELGPIDALFVG 176 Query: 177 VGTSGTLMGVGKNLREKNPEIKIIEAQ---------PTKGHYIQGLKSMEEAIVPAIYQA 227 GTSGTLMG + R I+ P K YI GL + + P IY Sbjct: 177 TGTSGTLMGCLEFRRTHRRRHTIVAVDSEGSVTFGGPPKRRYIPGLGASRK---PEIYSE 233 Query: 228 DKIDEHILIESEEAFAKAREIVAQEGIFIGMSSGAAMLAAQKLAEKIDSGV-IVVLFADR 286 + + +LI + A+ + G+ G S+G + A +K + G I + D Sbjct: 234 AESFDKVLIPEADTIAECHRLARTYGLLAGGSTGTVLAAIRKYGRRFPPGARIASISPDM 293 Query: 287 GEKYLST 293 GEKYL T Sbjct: 294 GEKYLPT 300 Lambda K H 0.315 0.133 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 254 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 299 Length of database: 321 Length adjustment: 27 Effective length of query: 272 Effective length of database: 294 Effective search space: 79968 Effective search space used: 79968 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory