Align O-succinylhomoserine sulfhydrylase; OSH sulfhydrylase; OSHS sulfhydrylase; EC 2.5.1.- (characterized)
to candidate WP_025272347.1 HALAL_RS0101720 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme
Query= SwissProt::P9WGB5 (406 letters) >NCBI__GCF_000527155.1:WP_025272347.1 Length = 380 Score = 179 bits (455), Expect = 9e-50 Identities = 123/342 (35%), Positives = 187/342 (54%), Gaps = 23/342 (6%) Query: 66 VYSRYGNPTVSVFEERLRLIEGAPAAFATASGMAAVFTSLGALLGAGDR-LVAARSLFGS 124 +Y+R NPTV+ FE+ L +E + AA A ASGMAA+ SL A G R +VA R ++G Sbjct: 59 IYARLHNPTVARFEKALAELEHSEAAVAFASGMAAMSASLLAATSGGKREIVAVRPVYGG 118 Query: 125 CFVVCSEILPRWGVQTVFVDGDDLSQWERALSVPTQAVFFETPSNPMQSLVDIAAVTELA 184 +V S L G + + D D ++ A++ T V ETP+NP + ++ ++A Sbjct: 119 TDLVLSTGL--LGTEVTWTDADSVAD---AITSNTALVIVETPANPT---LHELSIRDIA 170 Query: 185 HAAG-AKVVLDNVFATPLLQQGFPLGVDVVVYSGTKHIDGQGRVLGGAILGDREYIDGPV 243 A G +++DN ATP LQ G + ++S TK + G G V+GG + D + + Sbjct: 171 TACGDVPLLVDNTLATPALQNPIREGASIALHSATKALGGYGDVVGGVVACDEAFAQ-KM 229 Query: 244 QKLMRHTGPAMSAFNAWVLLKGLETLAIRVQHSNASAQRIAEFLNGHPSVRWVRYPYLPS 303 + + TG + A++L +GL TL +RV+ + +A +A L P V V YP L S Sbjct: 230 RSVRIATGGVLHPLAAYMLQRGLATLPLRVERMSRTAHDLAVRLQDDPRVSAVHYPGLNS 289 Query: 304 HPQYDLAKRQMSGGGTVVTFALDCPEDVAKQRAFEVLDKMRLIDISNNLGDAKSLVTHPA 363 + QM+ GGT+V+F + ED A +V+ K+ LI + +LG SL+ HPA Sbjct: 290 N-----RPSQMTSGGTMVSF--ETTED-----ARDVIKKVSLITPAVSLGSVDSLIQHPA 337 Query: 364 TTTHRAMGPEGRAAIGLGDGVVRISVGLEDTDDLIADIDRAL 405 + TH + P+ R G+ D ++R+SVGLE DDL AD+D AL Sbjct: 338 SLTHHVVDPDARETCGISDHLIRLSVGLESPDDLWADLDTAL 379 Lambda K H 0.319 0.135 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 393 Number of extensions: 26 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 380 Length adjustment: 31 Effective length of query: 375 Effective length of database: 349 Effective search space: 130875 Effective search space used: 130875 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory