Align 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54) (characterized)
to candidate WP_029909062.1 P166_RS0104215 3-deoxy-8-phosphooctulonate synthase
Query= BRENDA::Q9YEJ7 (270 letters) >NCBI__GCF_000711315.1:WP_029909062.1 Length = 278 Score = 109 bits (272), Expect = 7e-29 Identities = 79/252 (31%), Positives = 137/252 (54%), Gaps = 27/252 (10%) Query: 35 VIAGPCSVESWEQVREAALAVKEAGAHMLRGGAFKP------RTSPYSFQGLGLE-GLKL 87 +IAGPC +ES + + A +KE + FK R+S SF+GLG+E GL++ Sbjct: 16 LIAGPCVIESEQLAIDTAGQLKEMTDALGMPFIFKSSYDKANRSSTKSFRGLGIEEGLRI 75 Query: 88 LRRAGDEAGLPVVTEVLDPRHVETVSRYADMLQIGARNMQNFPLLREVGRSGKPVLLKRG 147 L++ DE G+PV+T+V + +E V+ D++Q A ++ ++ V R G PV +K+G Sbjct: 76 LQKVKDEVGVPVLTDVHEDTPLEEVASVVDVMQTPAFLVRQTNFIQNVCRQGLPVNIKKG 135 Query: 148 FGNT---VEELLAAAEYILLEGNWQVVLVERGIRTFEPSTRFTLDVAAVAVLKEATHLPV 204 +++++A A + GN Q+++ +RG +F +T + D+ +A ++ +T PV Sbjct: 136 QFQAPWDMDQVVAKAREV---GNEQIMVCDRG-TSFGYNTLIS-DMRGLASMR-STGCPV 189 Query: 205 IVDPSH-----------PAGRRSLVPALAKAGLAAGADGLIVEVHPNPEEALSDAKQQLT 253 + D +H G+R +VP LA+A +AAG G+ +E HP+P ALSD Sbjct: 190 VFDATHSVQQPGGQGTTSGGQREMVPVLARAAIAAGISGVFMETHPDPANALSDGPNMWP 249 Query: 254 PGEFARLMGELR 265 G+ L+ ++ Sbjct: 250 LGKLMPLLETMK 261 Lambda K H 0.318 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 161 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 270 Length of database: 278 Length adjustment: 25 Effective length of query: 245 Effective length of database: 253 Effective search space: 61985 Effective search space used: 61985 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory