Align [CysO sulfur-carrier protein]-thiocarboxylate-dependent cysteine synthase (EC 2.5.1.113); O-phosphoserine sulfhydrylase (EC 2.5.1.65) (characterized)
to candidate WP_029909155.1 P166_RS0104435 cysteine synthase CysM
Query= BRENDA::P9WP53 (323 letters) >NCBI__GCF_000711315.1:WP_029909155.1 Length = 297 Score = 211 bits (536), Expect = 2e-59 Identities = 116/302 (38%), Positives = 177/302 (58%), Gaps = 12/302 (3%) Query: 6 SLLQALGNTPLVGLQRLSPRWDDGRDGPHVRLWAKLEDRNPTGSIKDRPAVRMIEQAEAD 65 +L+ +GNTPL+ +QRL + + AKLE NP GS+KDRPA+ MI+QAE Sbjct: 3 TLMDVVGNTPLIKIQRLV------NANTNSVILAKLEGNNPAGSVKDRPALNMIKQAELR 56 Query: 66 GLLRPGATILEPTSGNTGISLAMAARLKGYRLICVMPENTSVERRQLLELYGAQIIFSAA 125 G ++PG T++E TSGNTGI+LAM A + GY++ +MP+N S+ER+ + YGA++I + Sbjct: 57 GEIKPGDTLIEATSGNTGIALAMVAAMLGYKMKLIMPDNMSMERKASMAAYGAELILVSK 116 Query: 126 EGGSNTAVATAKELAATNPSWVMLYQYGNPANTDSHYCGTGPELLADLP-EITHFVAGLG 184 E G A A+++ + V L Q+ NP N +HY TGPE+ + ITHFV+ +G Sbjct: 117 EEGMEGARDLAQKMQSEGQGTV-LDQFANPDNPLAHYFTTGPEIWDETEGNITHFVSAMG 175 Query: 185 TTGTLMGTGRFLREHVANVKIVAAEPRYGEGVYALRNMDEGFVPELYDPEILTARYSVGA 244 TTGT+MGT +L+E ++++V +P G + +R + ++P +YD + + Sbjct: 176 TTGTIMGTSMYLKEQNPDIQVVGVQPTEGSSIPGIRRWPKEYLPSIYDDSRVDRTIDMSQ 235 Query: 245 VDAVRRTRELVHTEGIFAGISTGAVLHAALGVGAGALAAGERADIALVVADAGWKYLSTG 304 A + + EGIFAG+S+G + AAL + E A I +V D G +YLSTG Sbjct: 236 ALAEDTMKRMAKEEGIFAGVSSGGAMAAALQIANET----ENALIVTIVCDRGDRYLSTG 291 Query: 305 AY 306 + Sbjct: 292 VF 293 Lambda K H 0.317 0.134 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 306 Number of extensions: 12 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 323 Length of database: 297 Length adjustment: 27 Effective length of query: 296 Effective length of database: 270 Effective search space: 79920 Effective search space used: 79920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory