Align D-3-phosphoglycerate dehydrogenase; PGDH; EC 1.1.1.95; 2-oxoglutarate reductase; EC 1.1.1.399 (uncharacterized)
to candidate WP_029912676.1 P166_RS0111135 4-phosphoerythronate dehydrogenase
Query= curated2:P35136 (525 letters) >NCBI__GCF_000711315.1:WP_029912676.1 Length = 374 Score = 112 bits (280), Expect = 2e-29 Identities = 106/332 (31%), Positives = 159/332 (47%), Gaps = 44/332 (13%) Query: 25 EIVQKNVADAEDELHTFDALLVRSATKVTEDLFNKMTSLKIVGRAGVGVDNIDIDEATKH 84 EI + V DA DAL+VRS T+V + L K +S++ VG VG+D+ID D Sbjct: 30 EITSETVKDA-------DALIVRSRTQVNQSLL-KNSSVEFVGSTVVGLDHIDQDYLASK 81 Query: 85 GVIVINAPNGNTISTAEHTFAMISSLMRHIPQANISVKSREWNRTAYVGSELYGKTLGIV 144 + +A N S +E+ +IS+L+ H + + G EL K+LGI+ Sbjct: 82 NIHFYSAQGCNANSVSEY---VISALL-HFAEEH--------------GFELSEKSLGII 123 Query: 145 GLGRIGSEIAQRARAFGMTVHVFDPFLTEERAKKIGVNSRTFEEVLESADIITVHTPLTK 204 G+G +G + Q+A A GMTV + DP R +K + + SADII+ HTPLTK Sbjct: 124 GVGNVGKLLEQKAIALGMTVFLNDP----PRQEKEDLPHFVDLDKALSADIISFHTPLTK 179 Query: 205 ETK----GLLNKETIAKTKKGVRLINCARGGIIDEAALLEALENGHVAGAALDVFEVEPP 260 + K LLN+ +IN ARGGIIDE+ + + ++ +D +E EP Sbjct: 180 DGKYPSHHLLNQNNFHLIHPSTVVINAARGGIIDESVWSKTETDINI----IDCWENEPN 235 Query: 261 VDNKLVDHPLVIATPHLGASTKEAQLNVAAQVSEEVLQFAKGLPVMS--AINLPAMTKDE 318 +D L IATPH+ EA++ ++ V E + Q P+ S +P T+ Sbjct: 236 IDANLY-QKADIATPHIAGHALEAKIKGSSMVYEVLCQH-WNQPIQSHWKAQVPHPTEPL 293 Query: 319 FAKIKPYHQIAGKIGSLVSQCMKEPVQDVAIQ 350 A Q + LV C + D+AI+ Sbjct: 294 TASYGDSFQ--SMLFKLVHHCYDPVIDDLAIR 323 Lambda K H 0.317 0.134 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 416 Number of extensions: 26 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 525 Length of database: 374 Length adjustment: 32 Effective length of query: 493 Effective length of database: 342 Effective search space: 168606 Effective search space used: 168606 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory